SAB2108744

Anti-ZEB2

affinity isolated antibody

• Synonyme(s) : Anti- SIP-1, Anti- SIP1, Anti- SMADIP1, Anti- ZFHX1B, Anti-KIAA0569
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Poids mol.: 136 kDa
• Espèces réactives: human, horse, mouse, bovine, pig, rat
• Concentration: 0.5-1 mg/mL
• Technique(s): immunoblotting: suitable; immunohistochemistry: suitable
• Numéro d'accès: NM_014795
• Numéro d'accès UniProt: O60315
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... ZEB2(9839)

Description

Immunogène

Synthetic peptide directed towards the middle region of human ZEB2

Actions biochimiques/physiologiques

The ZFHX1B gene is a member of the delta-EF1/Zfh1 family of 2-handed zinc finger/homeodomain proteins. ZFHX1B is strongly transcribed at an early stage in the developing peripheral and central nervous systems of both mice and humans, in all neuronal regions of the brains of 25-week human fetuses and adult mice, and in numerous nonneural tissues. The SMADIP1 gene (also known as SIP1) is a member of the delta-EF1 (ZEB1; MIM 189909)/Zfh1 family of 2-handed zinc finger/homeodomain proteins. SMADIP1 interacts with receptor-mediated, activated full-length SMADs (see MIM 605568) (Verschueren et al., 1999 [PubMed 10400677]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-58 AB056507.1 1-58 59-553 AL118674.1 57-551 554-5558 AB056507.1 553-5557 5559-5583 AI858477.1 1-25 c

Séquence

Synthetic peptide located within the following region: LGRQDGDEEFEEEEEESENKSMDTDPETIRDEEETGDHSMDDSSEDGKME

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 3
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable