Accéder au contenu
Merck
Toutes les photos(2)

Key Documents

SAB2106448

Sigma-Aldrich

Anti-SIX1 antibody produced in rabbit

affinity isolated antibody

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(2)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.43

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

32 kDa

Espèces réactives

human, guinea pig, rat, dog, horse, mouse, bovine, sheep, rabbit

Concentration

0.5 mg - 1 mg/mL

Technique(s)

immunohistochemistry: suitable
western blot: suitable

Numéro d'accès NCBI

NM_009189

Numéro d'accès UniProt

Q62231

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... SIX1(6495)
mouse ... Six1(20471)

Description générale

Sine oculis homeobox homolog 1 (SIX1) is a transcription factor, having a homeodomain. It is part of the homeoprotein family and is expressed during embryogenesis. The gene encoding this protein is localized on human chromosome 14q23.1.

Immunogène

The immunogen for anti-SIX1 antibody: synthetic peptide derected towards the N terminal of human SIX1

Actions biochimiques/physiologiques

Sine oculis homeobox homolog 1 (SIX1) enhances the rate of proliferation of cells and their survival. It has a role in organogenesis and has been linked to several malignancies.

Séquence

Synthetic peptide located within the following region: ERLGRFLWSLPACDHLHKNESVLKAKAVVAFHRGNFRELYKILESHQFSP

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Inhibition of Six1 affects tumour invasion and the expression of cancer stem cell markers in pancreatic cancer
Tristan L, et al.
BMC Cancer, 17(1), 249-249 (2017)
The role of Six1 signaling in paclitaxel-dependent apoptosis in MCF-7 cell line
Armat MA, et al.
Bosnian Journal of Basic Medical Sciences / Udruzenje Basicnih Mediciniskih Znanosti = Association of Basic Medical Sciences, 16(1), 28-28 (2016)
Aberrant expression of homeobox gene SIX1 in Hodgkin lymphoma.
Nagel S, et al.
Oncotarget, 6(37), 40112-40112 (2015)
Baowei Li et al.
Medical science monitor : international medical journal of experimental and clinical research, 24, 2271-2279 (2018-04-16)
BACKGROUND The objective of this study was to explore the role of SIX1 in paclitaxel (TAX) resistance of HepG2 cells via reactive oxygen species (ROS) and autophagy pathway. MATERIAL AND METHODS Hepatoma cell line HepG2 was treated with SIX1 knockdown
Jienan Kong et al.
International journal of clinical and experimental pathology, 7(6), 3018-3027 (2014-07-18)
High expression levels of the human sineoculis homeobox homolog 1 (SIX1) gene have been correlated with numerous human malignancies. The SIX1 protein is involved in chromatin reconstruction and gene transcription, and plays an important role in cell apoptosis. This study

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique