Accéder au contenu
Merck
Toutes les photos(2)

Key Documents

AV45774

Sigma-Aldrich

Anti-PFKL antibody produced in rabbit

IgG fraction of antiserum

Synonyme(s) :

Anti-DKFZp686G1648, Anti-DKFZp686L2097, Anti-FLJ30173, Anti-FLJ40909, Anti-PFK-B, Anti-Phosphofructokinase, liver

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(2)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

IgG fraction of antiserum

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

64 kDa

Espèces réactives

rat, mouse, bovine, dog, guinea pig, horse, human

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

NP_002617

Numéro d'accès UniProt

P17858

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... PFKL(5211)

Immunogène

Synthetic peptide directed towards the middle region of human PFKL

Actions biochimiques/physiologiques

Phosphofructokinase (PFK; ATP: D-fructose-6-phosphate 1-phosphotransferase), the key regulatory enzyme of glycolysis, is a tetrameric protein. Three structural loci encode three distinct PFK units, muscle (PFKM) liver (PFKL), and platelet (PFKP). Each subunit is encoded by a separate gene; except PFKL, which maps to chromosome 21.

Séquence

Synthetic peptide located within the following region: RTNVLGHLQQGGAPTPFDRNYGTKLGVKAMLWLSEKLREVYRKGRVFANA

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

R M Kay et al.
The American journal of clinical nutrition, 30(2), 171-175 (1977-02-01)
Citrus pectin (15 g/day) was added for 3 weeks to metabolically controlled diets in nine subjects. Pectin was consumed with fruit and sugar as a gel in divided doses with meals. Plasma cholesterol concentrations were reduced by a mean of
A Elson et al.
The Biochemical journal, 299 ( Pt 2), 409-415 (1994-04-15)
The human liver-type subunit of the key glycolytic enzyme, phosphofructokinase (PFKL), is encoded by a gene residing on chromosome 21. This chromosome, when triplicated, causes the phenotypic expression of Down's syndrome (trisomy 21). Increased phosphofructokinase activity, a result of gene
Daniel B Graham et al.
Nature communications, 6, 7838-7838 (2015-07-22)
The phagocyte oxidative burst, mediated by Nox2 NADPH oxidase-derived reactive oxygen species, confers host defense against a broad spectrum of bacterial and fungal pathogens. Loss-of-function mutations that impair function of the Nox2 complex result in a life-threatening immunodeficiency, and genetic

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique