AV42196

Anti-ITGBL1 (AB1) antibody produced in rabbit

IgG fraction of antiserum

• Synonyme(s) : Anti-Integrin, β-like 1 (with EGF-like repeat domains), Anti-OSCP, Anti-TIED
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: IgG fraction of antiserum
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Poids mol.: 54 kDa
• Espèces réactives: horse, pig, dog, human
• Concentration: 0.5 mg - 1 mg/mL
• Technique(s): western blot: suitable
• Numéro d'accès NCBI: NP_004782
• Numéro d'accès UniProt: O95965
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... ITGBL1(9358)

Description

Description générale

Integrin, β-like 1 (with EGF-like repeat domains) (ITGBL1, TIED) is a β integrin-related protein found in aorta, thymus and osteogenic sarcoma. Defects in ITGBL1 may be associated with isolated growth hormone deficiency.

Spécificité

Anti-ITGBL1 (AB1) polyclonal antibody reacts with canine, human, bovine, mouse, and rat integrin, β-like 1 (with EGF-like repeat domains) proteins.

Immunogène

Synthetic peptide directed towards the N terminal region of human ITGBL1

Application

Anti-ITGBL1 (AB1) polyclonal antibody is used to tag integrin, β-like 1 (with EGF-like repeat domains) protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of integrin, β-like 1 (with EGF-like repeat domains) in cell processes such as isolated growth hormone deficiency

Séquence

Synthetic peptide located within the following region: MRPPGFRNFLLLASSLLFAGLSAVPQSFSPSLRSWPGAACRLSRAESERR

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 3
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable