WH0170691M1

Monoclonal Anti-ADAMTS17 antibody produced in mouse

clone 3B7, purified immunoglobulin, buffered aqueous solution

• Sinónimos: Anti-ADAM metallopeptidase with thrombospondin type 1 motif, 17, Anti-FLJ32769
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: mouse
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: purified immunoglobulin
• tipo de anticuerpo: primary antibodies
• clon: 3B7, monoclonal
• Formulario: buffered aqueous solution
• reactividad de especies: human, mouse, rat
• técnicas: indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotipo: IgG1κ
• Nº de acceso GenBank: NM_139057
• Nº de acceso UniProt: Q8TE56
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... ADAMTS17(170691)

Descripción

Descripción general

This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. ADAMTS family members share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The protein encoded by this gene has a high sequence similarity to the protein encoded by ADAMTS19, another family member. The function of this protein has not been determined. (provided by RefSeq)

Inmunógeno

ADAMTS17 (NP_620688, 543 a.a. ~ 650 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
DGDWSPWGAWSMCSRTCGTGARFRQRKCDNPPPGPGGTHCPGASVEHAVCENLPCPKGLPSFRDQQCQAHDRLSPKKKGLLTAVVVDDKPCELYCSPLGKESPLLVAD

Acciones bioquímicas o fisiológicas

ADAM metallopeptidase with thrombospondin type 1 motif 17 (ADAMTS17) is associated with Weill-Marchesani-like syndrome. Knockdown of the protein has been shown to prevent the growth of breast cancer cells in vitro. ADAMTS17 binds to the extracellular matrix.

Forma física

Solution in phosphate buffered saline, pH 7.4

Información legal

GenBank is a registered trademark of United States Department of Health and Human Services

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): nwg
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable
• Equipo de protección personal: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)