Saltar al contenido
MilliporeSigma
Todas las fotos(3)

Documentos clave

SAB1412393

Sigma-Aldrich

ANTI-SREBF1 antibody produced in mouse

clone 4G4, purified immunoglobulin, buffered aqueous solution

Sinónimos:

SREBF1, SREBP-1c, SREBP1, bHLHd1

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

mouse

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

purified immunoglobulin

tipo de anticuerpo

primary antibodies

clon

4G4, monoclonal

Formulario

buffered aqueous solution

mol peso

antigen 36.63 kDa

reactividad de especies

human

técnicas

indirect ELISA: suitable
western blot: 1-5 μg/mL

isotipo

IgG2aκ

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

dry ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... SREBF1(6720)

Descripción general

Sterol regulatory element binding transcription factor 1 (SREBF1) gene is located on human chromosome 17p11.2. SREBF1 encodes the transcription factors SREBP-1a and SREBP-1c. SREBP-1a is expressed in spleen and intestine.SREBP-1c is expressed in liver, adipose tissue and skeletal muscle.

Inmunógeno

SREBF1 (AAH57388, 801 a.a. ~ 900 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
VTQLFREHLLERALNCVTQPNPSPGSADGDKEFSDALGYLQLLNSCSDAAGAPAYSFSISSSMATTTGVDPVAKWWASLTAVVIHWLRRDEEAAERLCPL

Acciones bioquímicas o fisiológicas

Sterol regulatory element binding transcription factor 1 (SREBF1) regulates lipogenesis, energy homeostasis and insulin sensitivity. It is associated with non-alcoholic fatty liver disease (NAFLD). SREBF1 promotes tumor growth in various cancers. SREBF1 acts as a molecular bridge between lipogenesis and cell cycle control clear cell renal carcinoma.

Forma física

Solution in phosphate buffered saline, pH 7.4

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

SREBP-1c as a molecular bridge between lipogenesis and cell cycle progression of clear cell renal carcinoma
Sethi G, et al.
Bioscience Reports, BSR20171270-BSR20171270 (2017)
54G/C polymorphism of SREBF-1 gene is associated with polycystic ovary syndrome
Li L, et al.
European Journal of Obstetrics, Gynecology, and Reproductive Biology, 188, 95-99 (2015)
Association of variants in the sterol regulatory element-binding factor 1 gene (SREBF1) with type 2 diabetes, glycemia, and insulin resistance-A study of 15,734 Danish subjects
Grarup MDN, et al.
Diabetes (2008)
Lack of association between SREBF-1c gene polymorphisms and risk of non-alcoholic fatty liver disease in a Chinese Han population
Peng XE, et al.
Scientific reports, 6, 32110-32110 (2016)
Structure of the human gene encoding sterol regulatory element binding protein-1 (SREBF1) and localization of SREBF1 and SREBF2 to chromosomes 17p11. 2 and 22q13.
Hua X, et al.
Genomics, 25(3), 667-673 (1995)

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico