AV35126

Anti-KCNAB1 antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-Potassium voltage-gated channel, shaker-related subfamily, β member 1
• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 46 kDa
• species reactivity: rat, dog, bovine, mouse, human, rabbit, guinea pig, horse
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_003462
• UniProt accession no.: Q14722
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... KCNAB1(7881)

Descripción

General description

KCNAB1 codes for a member of potassium voltage-gated channel (shaker-related) protein subfamily. KCNAB1 forms a β subunit and associates with α subunits to form heteromeric complexes that modulate pore formation. Genetic variations in KCNAB1 have been linked to lateral temporal epilepsy.
Rabbit Anti-KCNAB1 antibody recognizes rabbit, canine, human, mouse, rat, chicken, pig, bovine, and zebrafish KCNAB1.

Immunogen

Synthetic peptide directed towards the C terminal region of human KCNAB1

Application

Rabbit Anti-KCNAB1 antibody is suitable for western blot applications at a concentration of 1 μg/ml.

Biochem/physiol Actions

Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. The KCNAB1 gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily.

Sequence

Synthetic peptide located within the following region: VPESSRASLKCYQWLKERIVSEEGRKQQNKLKDLSPIAERLGCTLPQLAV

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 2
• flash_point_f: Not applicable
• flash_point_c: Not applicable