SAB1401287

Monoclonal Anti-PLXNA2 antibody produced in mouse

clone 2G5, purified immunoglobulin, buffered aqueous solution

• Synonym(s): FLJ11751, FLJ30634, KIAA0463, OCT, PLXN2
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 2G5, monoclonal
• form: buffered aqueous solution
• species reactivity: rat, human, mouse
• technique(s): capture ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG2bκ
• NCBI accession no.: BC032125
• UniProt accession no.: O75051
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... PLXNA2(5362)

Description

General description

This gene encodes a member of the plexin-A family of semaphorin co-receptors. Semaphorins are a large family of secreted or membrane-bound proteins that mediate repulsive effects on axon pathfinding during nervous system development. A subset of semaphorins are recognized by plexin-A/neuropilin transmembrane receptor complexes, triggering a cellular signal transduction cascade that leads to axon repulsion. This plexin-A family member is thought to transduce signals from semaphorin-3A and -3C. (provided by RefSeq)

Immunogen

PLXNA2 (AAH32125, 1 a.a. ~ 164 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MHSQVFSAFPYSLPLRFWVNVIKNPQFVFDIHKGSITDACLSVVAQTFMDSCSTSEHRLDKDSPSNKLLYAKDIPSYKSWVERYYADIAKLPAISDQDMNAYLAEQSRLHAVEFNMLSALNEIYSYVSKYSEELIGALEQDEQARRQRLAYKVEQLINAMSIES

Physical form

Solution in phosphate buffered saline, pH 7.4

Safety Information

• Storage Class: 10 - Combustible liquids
• flash_point_f: Not applicable
• flash_point_c: Not applicable