SAB2103790

Anti-RNPC3 antibody produced in rabbit

affinity isolated antibody

• Synonym(s): Anti-FLJ20008, Anti-FLJ25070, Anti-KIAA183, Anti-RBM40, Anti-RNP
• MDL number: MFCD02264067
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: rabbit
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 58 kDa
• species reactivity: human
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NM_017619
• UniProt accession no.: Q96LT9
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... RNPC3(55599)

Description

Immunogen

Synthetic peptide directed towards the middle region of human RNPC3

Biochem/physiol Actions

RNPC3 is an RNA-binding protein involved in pre-mRNA splicing. RNPC3 participates in pre-mRNA U12-dependent splicing. RNPC3 binds to the 3′-stem-loop of m7G-capped U12 snRNA.Two types of spliceosomes catalyze splicing of pre-mRNAs. The major U2-type spliceosome is found in all eukaryotes and removes U2-type introns, which represent more than 99% of pre-mRNA introns. The minor U12-type spliceosome is found in some eukaryotes and removes U12-type introns, which are rare and have distinct splice consensus signals. The U12-type spliceosome consists of several small nuclear RNAs and associated proteins. This gene encodes a 65K protein that is a component of the U12-type spliceosome. This protein contains two RNA recognition motifs (RRMs), suggesting that it may contact one of the small nuclear RNAs of the minor spliceosome.

Sequence

Synthetic peptide located within the following region: LHAPLPPTSPQPPEEPPLPDEDEELSSEESEYESTDDEDRQRMNKLMELA

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 12 - Non Combustible Liquids
• WGK: WGK 3
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable