HPA042608
Anti-COL4A3BP antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody
Synonym(s):
CERT, GPBP, STARD11
Sign Into View Organizational & Contract Pricing
All Photos(2)
About This Item
UNSPSC Code:
12352200
Human Protein Atlas Number:
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
technique(s)
immunoblotting: 0.4 μg/mL
immunofluorescence: 1-4 μg/mL
immunogen sequence
SGASGYSATSTSSFKKGHSLREKLAEMETFRDILCRQVDTLQKYFDACADAVSKDELQRDKVVEDDEDDFPTTRSDGDFLH
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... COL4A3BP(10087)
General description
Collagen type IV alpha-3-binding protein (COL4A3BP), also called as goodpasture antigen-binding protein or ceramide transfer protein (CERT), is a 68 kDa protein with N-terminal pleckstrin homology (PH), a central domain and a C-terminal steroidogenic acute regulatory protein-related lipid transfer (START) domain. COL4A3BP gene has 17 exons and is mapped to human chromosome 5q13.3.
Immunogen
collagen, type IV, alpha 3 (Goodpasture antigen) binding protein
Application
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Biochem/physiol Actions
Ceramide transfer protein (CERT) binds to phosphoinositide through its pleckstrin domain. CERT interacts with ceramide via steroidogenic acute regulatory protein-related lipid transfer domain (START) and mediates ceramide transport for sphingomyelin synthesis from endoplasmic reticulum to Golgi complex. Mutations in the COL4A3BP may contribute to intellectual disability.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Linkage
Corresponding Antigen APREST89449.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Not finding the right product?
Try our Product Selector Tool.
Signal Word
Warning
Hazard Statements
Precautionary Statements
Hazard Classifications
Eye Irrit. 2 - Skin Irrit. 2
Storage Class Code
12 - Non Combustible Liquids
WGK
WGK 1
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Choose from one of the most recent versions:
Certificates of Analysis (COA)
Lot/Batch Number
Don't see the Right Version?
If you require a particular version, you can look up a specific certificate by the Lot or Batch number.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Crystal structures of the CERT START domain with inhibitors provide insights into the mechanism of ceramide transfer
Kudo N, et al.
Journal of Molecular Biology, 396(2), 245-251 (2010)
Discovery of the molecular machinery CERT for endoplasmic reticulum-to-Golgi trafficking of ceramide
Hanada K
Molecular and Cellular Biochemistry, 286(1-2), 23-31 (2006)
De novo mutations in moderate or severe intellectual disability
Hamdan FF, et al.
PLoS Genetics, 10(10), e1004772-e1004772 (2014)
CERT and intracellular trafficking of ceramide
Hanada K, et al.
Biochimica et Biophysica Acta - Molecular and Cell Biology of Lipids, 1771(6), 644-653 (2007)
Molecular machinery for non-vesicular trafficking of ceramide
Hanada K, et al.
Nature, 426(6968), 803-809 (2003)
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service