SAB2108601

Anti-NOX1

affinity isolated antibody

• Sinónimos: Anti- MOX1, Anti- NOH-1, Anti- NOH1, Anti-GP91-2
• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 65 kDa
• species reactivity: rabbit, horse, human, rat, dog, bovine, guinea pig
• concentration: 0.5-1 mg/mL
• technique(s): immunoblotting: suitable
• accession no.: NM_007052
• UniProt accession no.: Q9Y5S8
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... NOX1(27035)

Descripción

Immunogen

Synthetic peptide directed towards the C terminal region of human NOX1

Biochem/physiol Actions

Voltage-gated proton (hydrogen) channels play an important role in cellular defense against acidic stress. They are unique among ion channels with respect to their extremely high selectivity, marked temperature dependence, and unitary conductance, which is 3 orders of magnitude lower than that of most other ion channels. NOX1 is a homolog of the catalytic subunit of the superoxide-generating NADPH oxidase of phagocytes, gp91phox.Voltage-gated proton (hydrogen) channels play an important role in cellular defense against acidic stress. They are unique among ion channels with respect to their extremely high selectivity, marked temperature dependence, and unitary conductance, which is 3 orders of magnitude lower than that of most other ion channels. NOX1 is a homolog of the catalytic subunit of the superoxide-generating NADPH oxidase of phagocytes, gp91phox. Three splice variants of NOX1 have been identified, NOH-1L, NOH-1S and NOH-1Lv. The NOH-1S currents were reversibly blocked by zinc, a known H+ channel inhibitor. The NOH-1S variant does not contain an electron transport chain and it is thought that H+ conductance is its main physiologic function, whereas NOH-1L may conduct H+ ions as part of its electron transport mechanism.

Sequence

Synthetic peptide located within the following region: STIATSHPKSVVGVFLCGPRTLAKSLRKCCHRYSSLDPRKVQFYFNKENF

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable