WH0000516M1

Monoclonal Anti-ATP5G1 antibody produced in mouse

clone 1A12, purified immunoglobulin, buffered aqueous solution

• Synonym(s): Anti-ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C1 (subunit 9), Anti-ATP5A, Anti-ATP5G
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 1A12, monoclonal
• form: buffered aqueous solution
• species reactivity: human
• technique(s): indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG1κ
• GenBank accession no.: BC004963
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... ATP5G1(516)

Description

General description

ATP synthase membrane subunit c locus 1 (ATP5G1) is encoded by the gene mapped to human chromosome 17q21.32. The encoded protein belongs to the low transcript gene group.

This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (α, β, γ, δ, and ε) assembled with a stoichiometry of 3 α, 3 β, and a single representative of the other 3. The proton channel seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene is one of three genes that encode subunit c of the proton channel. Each of the three genes have distinct mitochondrial import sequences but encode the identical mature protein. Alternatively spliced transcript variants encoding the same protein have been identified. (provided by RefSeq)

Immunogen

ATP5G1 (AAH04963, 18 a.a. ~ 136 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
TRGLIRPVSASFLSSPVNSSKQPSYSNFPLQVARREFQTSVVSRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM

Biochem/physiol Actions

ATP synthase membrane subunit c locus 1 (ATP5G1) is one among the three genes that encodes mitochondrial ATP synthase subunit c of the proton channel. Regulation of this protein is implicated in the biogenesis of mammalian H⁺ -ATP synthase. Mutation in the gene is associated with the development of coronary artery disease (CAD).

Features and Benefits

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 10 - Combustible liquids
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable
• Personal Protective Equipment: dust mask type N95 (US), Eyeshields, Gloves