AV39509

Anti-FOXA2 (AB2) antibody produced in rabbit

IgG fraction of antiserum

• Synonym(s): Anti-Forkhead box A2
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: IgG fraction of antiserum
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 48 kDa
• species reactivity: human
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_068556
• UniProt accession no.: Q9Y261
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... FOXA2(3170)

Description

General description

Forkhead proteins are transcription factors that contain a DNA binding motif, winged helix, called a forkhead box. These proteins regulate genes involved in major cell processes such as embryonic development, cell proliferation and differentiation. Forkhead box A2 (FOXA2, hepatic nuclear factor 3β, HNF3), a member of the forkhead regulatory factors, interacts with the androgen receptors to regulate prostate and epididymal genes and is as an essential activator of genes that function in multiple pathways governing insulin secretion.

Specificity

Anti-FOXA2 (AB2) polyclonal antibody reacts with human, mouse, rat, and canine forkhead box A2 (hepatic nuclear factor 3β, HNF3) proteins.

Immunogen

Synthetic peptide directed towards the C terminal region of human FOXA2

Application

Anti-FOXA2 (AB2) polyclonal antibody is used to tag forkhead box A2 protein for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the possible roles of forkhead box A2 protein in regulation of gene sets involved with processes such as reproduction and insulin secretion.

Biochem/physiol Actions

FOXA2 is a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. This gene has been linked to sporadic cases of maturity-onset diabetes of the young.This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. This gene has been linked to sporadic cases of maturity-onset diabetes of the young. Two transcript variants encoding the same protein have been identified for this gene.

Sequence

Synthetic peptide located within the following region: QVMHYPGYGSPMPGSLAMGPVTNKTGLDASPLAADTSYYQGVYSRPIMNS

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable