AV02040

Anti-TNFSF10 antibody produced in rabbit

affinity isolated antibody

• Synonym(s): Anti-Tumor necrosis factor (ligand) superfamily, member 10
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 33 kDa
• species reactivity: human
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_003801
• UniProt accession no.: P50591
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... TNFSF10(8743)

Description

General description

TNFSF10 (TRAIL) is a p53 target gene that regulates p53-dependent apoptosis.
Rabbit Anti-TNFSF10 antibody binds to human, canine, and pig TNFSF10.

Immunogen

Synthetic peptide directed towards the N terminal region of human TNFSF10

Application

Rabbit Anti-TNFSF10 antibody can be used for western blot assays at 1.0μg/ml.

Sequence

Synthetic peptide located within the following region: CFLKEDDSYWDPNDEESMNSPCWQVKWQLRQLVRKMILRTSEETISTVQE

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable