Skip to Content
MilliporeSigma
All Photos(1)

Documents

SAB2107086

Sigma-Aldrich

Anti-SNX10 antibody produced in rabbit

affinity isolated antibody

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

22 kDa

species reactivity

rat, human, mouse, bovine, pig, horse, rabbit

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... SNX10(29887)
mouse ... Snx10(71982)

Related Categories

General description

Sorting nexin 10 (SNX10) is a transmembrane protein belonging to SNX family. SNX10 has phox domain which binds to phosphoinositide-binding domain. In human chromosome, the gene SNX10 is located on 7p15.2.

Immunogen

The immunogen for anti-SNX10 antibody: synthetic peptide derected towards the middle region of human SNX10

Biochem/physiol Actions

Snx10 may be involved in several stages of intracellular trafficking. May play a role in endosome homeostasis. Overexpression causes formation of huge vacuoles. Mutations in SNX10 leads to autosomal recessive osteoporosis due to dysregulation of osteoclasts. SNX10 interaction with vacuolar-type H+ -ATPase (V-ATPase) complex initiates ciliogenesis, critical for early embryonic development.

Sequence

Synthetic peptide located within the following region: DFLRKVLQNALLLSDSSLHLFLQSHLNSEDIEACVSGQTKYSVEEAIHKF

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

12 - Non Combustible Liquids

wgk_germany

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

SNX10 gene mutation leading to osteopetrosis with dysfunctional osteoclasts
Stattin EL, et al.
Scientific Reports, 7(1), 3012-3012 (2017)
Ting Hu et al.
Folia neuropathologica, 59(4), 359-371 (2022-02-05)
Gliomas are the most seen tumours in adults in the central nervous system, and high grade of gliomas cause the worse prognose of patients with a shorter survival period. Ubiquitin-specific protease 38 (USP38) has been regarded as the negative regulator
A novel mutation in SNX10 gene causes malignant infantile Osteopetrosis
Amirfiroozy A, et al.
Avicenna Journal of Medical Biotechnology, 9(4), 205-205 (2017)
An inducible explant model of osteoclast-osteoprogenitor coordination in exacerbated osteoclastogenesis.
Whitlock, et al.
iScience, 26, 106470-106470 (2023)
Yanqun Chen et al.
Cell research, 22(2), 333-345 (2011-08-17)
Sorting nexins (SNXs) are phosphoinositide-binding proteins implicated in the sorting of various membrane proteins in vitro, but the in vivo functions of them remain largely unknown. We reported previously that SNX10 is a unique member of the SNX family genes

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service