AV42455
Anti-ABHD5 (AB2) antibody produced in rabbit
IgG fraction of antiserum
Synonym(s):
Anti-Abhydrolase domain containing 5, Anti-CDS, Anti-CGI58, Anti-IECN2, Anti-MGC8731, Anti-NCIE2
Sign Into View Organizational & Contract Pricing
All Photos(1)
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
Recommended Products
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
IgG fraction of antiserum
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
39 kDa
species reactivity
rabbit, dog, bovine, mouse, rat, sheep, human, horse
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
Gene Information
human ... ABHD5(51099)
General description
ABHD5/CGI58 product 1-acylglycerol-3-phosphate O-acyltransferase is a signaling agent that co-activates adipose triglyceride lipase and acylation of lysophosphatidic acid (LPA). ABHD5 (1-acylglycerol-3-phosphate O-acyl-transferase) is a member of the esterase/lipase/thioesterase subfamily that has been associated with a triglyceride storage disease involving impaired long-chain fatty acid oxidation, known as Chanarin-Dorfman syndrome, a rare neutral lipid disorder characterised by icthyosis, hepatic steatosis.
Specificity
Anti-ABHD5/CGI58 antibody reacts with a sequence of the enzyme human1-acylglycerol-3-phosphate O-acyltransferase.
Immunogen
Synthetic peptide directed towards the N terminal region of human ABHD5
Application
Anti-ABHD5/CGI58 is a rabbit IgG polyclonal antibody used to tag comparative gene identification 58 (CGI58) proteins for detection and quantitation by Western blotting and in tissues by immunohistochemical (IHC) techniques.
Biochem/physiol Actions
ABHD5 belongs to a large family of proteins defined by an alpha/beta hydrolase fold, and contains three sequence motifs that correspond to a catalytic triad found in the esterase/lipase/thioesterase subfamily. It differs from other members of this subfamily in that its putative catalytic triad contains an asparagine instead of the serine residue. Mutations in ABHD5 gene have been associated with Chanarin-Dorfman syndrome, a triglyceride storage disease with impaired long-chain fatty acid oxidation.The protein encoded by this gene belongs to a large family of proteins defined by an alpha/beta hydrolase fold, and contains three sequence motifs that correspond to a catalytic triad found in the esterase/lipase/thioesterase subfamily. It differs from other members of this subfamily in that its putative catalytic triad contains an asparagine instead of the serine residue. Mutations in this gene have been associated with Chanarin-Dorfman syndrome, a triglyceride storage disease with impaired long-chain fatty acid oxidation.
Sequence
Synthetic peptide located within the following region: NRPVYAFDLLGFGRSSRPRFDSDAEEVENQFVESIEEWRCALGLDKMILL
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class
10 - Combustible liquids
wgk_germany
WGK 3
flash_point_f
Not applicable
flash_point_c
Not applicable
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Caleb C Lord et al.
Diabetes, 61(2), 355-363 (2012-01-10)
Mutations of comparative gene identification 58 (CGI-58) in humans cause Chanarin-Dorfman syndrome, a rare autosomal recessive disease in which excess triacylglycerol (TAG) accumulates in multiple tissues. CGI-58 recently has been ascribed two distinct biochemical activities, including coactivation of adipose triglyceride
Gabriela Montero-Moran et al.
Journal of lipid research, 51(4), 709-719 (2009-10-06)
Mutations in human CGI-58/ABHD5 cause Chanarin-Dorfman syndrome (CDS), characterized by excessive storage of triacylglycerol in tissues. CGI-58 is an alpha/beta-hydrolase fold enzyme expressed in all vertebrates. The carboxyl terminus includes a highly conserved consensus sequence (HXXXXD) for acyltransferase activity. Mouse
Ananda K Ghosh et al.
The Journal of biological chemistry, 283(36), 24525-24533 (2008-07-09)
cgi-58 (comparative gene identification-58) is a member of alpha/beta-hydrolase family of proteins. Mutations in CGI-58 are shown to be responsible for a rare genetic disorder known as Chanarin-Dorfman syndrome, characterized by an excessive accumulation of triacylglycerol in several tissues and
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service