AV35952

Anti-ZNF83 antibody produced in rabbit

affinity isolated antibody

• Synonym(s): Anti-FLJ11015, Anti-FLJ14876, Anti-FLJ30097, Anti-FLJ90585, Anti-HPF1, Anti-MGC33853, Anti-ZNF816B, Anti-Zinc finger protein 83
• NACRES: NA.41
• UNSPSC Code: 12352203
• Conjugate: unconjugated
• Clone: polyclonal
• Application: WB
• Citations: 2

Properties

• biological source: rabbit
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 60 kDa
• species reactivity: human
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_060770
• UniProt accession no.: Q6PI08
• shipped in: wet ice
• storage temp.: −20°C
• Gene Information: human ... ZNF83(55769)

Description

Immunogen

Synthetic peptide directed towards the N terminal region of human ZNF83

Biochem/physiol Actions

ZNF83 is a transcription factor characterized by the presence of Krüppel-associated boxes or KRAB domain. Zinc finger proteins have diverse functions that include activation of transcription, regulation of apoptosis, protein folding, RNA packaging and lipid binding.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: HGRKDDAQKQPVKNQLGLNPQSHLPELQLFQAEGKIYKYDHMEKSVNSSS

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class: 10 - Combustible liquids
• WGK: WGK 2
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable