AV48046

Anti-YWHAZ antibody produced in rabbit

IgG fraction of antiserum

• Synonym(s): Anti-KCIP-1, Anti-MGC111427, Anti-MGC126532, Anti-MGC138156, Anti-Tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: IgG fraction of antiserum
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 28 kDa
• species reactivity: rat, mouse, horse, rabbit, human, guinea pig, dog, bovine, sheep
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_001129171
• UniProt accession no.: P63104
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... YWHAZ(7534)

Description

General description

Tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta (YWHAZ) is a member of the 14-3-3 family that regulates signal transduction. Increased expression of YWHAZ has been linked to the growth and metastasis of gastric carcinoma. YWHAZ amplification is associated with breast cancer recurrence and chemotherapy resistance.
Rabbit Anti-YWHAZ antibody recognizes chicken, bovine, pig, human, mouse, rat, and canine YWHAZ.

Immunogen

Synthetic peptide directed towards the C terminal region of human YWHAZ

Application

Rabbit Anti-YWHAZ antibody is suitable for western blot applications at a concentration of 5μg/ml.

Biochem/physiol Actions

YWHAZ belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and sheep orthologs. The protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity.This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and sheep orthologs. The encoded protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity. Two transcript variants differing in the 5′ UTR, but encoding the same protein, have been identified for this gene.

Sequence

Synthetic peptide located within the following region: AFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGE

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable