WH0007291M1

Monoclonal Anti-TWIST1 antibody produced in mouse

clone 3E11, purified immunoglobulin, buffered aqueous solution

• Synonim(y): Anti-ACS3, Anti-BPES2, Anti-BPES3, Anti-SCS, Anti-TWIST, Anti-twist homolog 1 (acrocephalosyndactyly 3; Saethre-Chotzen syndrome) (Drosophila)
• Numer MDL: MFCD08705531
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: mouse
• białko sprzężone: unconjugated
• forma przeciwciała: purified immunoglobulin
• rodzaj przeciwciała: primary antibodies
• klon: 3E11, monoclonal
• Postać: buffered aqueous solution
• reaktywność gatunkowa: human
• metody: immunoprecipitation (IP): suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• izotyp: IgG1κ
• numer dostępu GenBank: NM_000474
• numer dostępu UniProt: Q15672
• Warunki transportu: dry ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... TWIST1(7291)

Opis

Opis ogólny

Twist family bHLH transcription factor 1 (TWIST1) is a basic helix-loop-helix transcription factor and the gene encoding it is localized on human chromosome 7p21.1.

Immunogen

TWIST1 (NP_000465, 100 a.a. ~ 202 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PQSYEELQTQRVMANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAFSVWRMEGAWSMSASH

Działania biochem./fizjol.

Twist family bHLH transcription factor 1 (TWIST1) has a role in the determination of cell lineage and differentiation during embryogenesis. During the development of neural crest, it is also involved in modulating cell movement and tissue reorganization. Mutations in the TWIST1 gene have been associated with Saethre-Chotzen syndrome (4) and the protein is also linked to various cancers.

Postać fizyczna

Solution in phosphate buffered saline, pH 7.4

Informacje prawne

GenBank is a registered trademark of United States Department of Health and Human Services

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable
• Środki ochrony indywidualnej: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)