WH0000094M1

Monoclonal Anti-ACVRL1 antibody produced in mouse

clone 5B1, purified immunoglobulin, buffered aqueous solution

• Synonim(y): Anti-ACVRLK1, Anti-ALK1, Anti-HHT, Anti-HHT2, Anti-ORW2, Anti-SKR3, Anti-activin A receptor type II-like 1
• Numer MDL: MFCD03791400
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: mouse
• białko sprzężone: unconjugated
• forma przeciwciała: purified immunoglobulin
• rodzaj przeciwciała: primary antibodies
• klon: 5B1, monoclonal
• Postać: buffered aqueous solution
• reaktywność gatunkowa: human
• metody: indirect ELISA: suitable; western blot: 1-5 μg/mL
• izotyp: IgG1κ
• numer dostępu GenBank: BC042637
• numer dostępu UniProt: P37023
• Warunki transportu: dry ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... ACVRL1(94)

Opis

Opis ogólny

This gene encodes a type I cell-surface receptor for the TGF-beta superfamily of ligands. It shares with other type I receptors a high degree of similarity in serine-threonine kinase subdomains, a glycine- and serine-rich region (called the GS domain) preceding the kinase domain, and a short C-terminal tail. The encoded protein, sometimes termed ALK1, shares similar domain structures with other closely related ALK or activin receptor-like kinase proteins that form a subfamily of receptor serine/threonine kinases. Mutations in this gene are associated with hemorrhagic telangiectasia type 2, also known as Rendu-Osler-Weber syndrome 2. (provided by RefSeq)

Immunogen

ACVRL1 (AAH42637, 22 a.a. ~ 119 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
DPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDGQL

Cechy i korzyści

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Postać fizyczna

Solution in phosphate buffered saline, pH 7.4

Informacje prawne

GenBank is a registered trademark of United States Department of Health and Human Services

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable
• Środki ochrony indywidualnej: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)