SAB2109073

Anti-USP30 antibody produced in rabbit

affinity isolated antibody

• Synonim(y): FLJ40511, MGC10702
• Kod UNSPSC: 12352203
• NACRES: NA.43

Właściwości

• pochodzenie biologiczne: rabbit
• białko sprzężone: unconjugated
• forma przeciwciała: affinity isolated antibody
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• Postać: buffered aqueous solution
• masa cząsteczkowa: 57 kDa
• reaktywność gatunkowa (przewidywana na podstawie homologii): canine, rabbit, horse, human, bovine, rat, guinea pig, mouse
• stężenie: 0.5 mg/mL
• metody: western blot: 1 μg/mL
• numer dostępu NCBI: NM_032663
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... USP30(57396)

Opis

Opis ogólny

USP30, a member of the ubiquitin-specific protease family (see USP1, MIM 603478), is a novel mitochondrial deubiquitinating (DUB) enzyme (Nakamura and Hirose, 2008 [PubMed 18287522]).

Immunogen

Synthetic peptide directed towards the middle region of human USP30

Sekwencja

Synthetic peptide located within the following region: SCLLDVLRMYRWQISSFEEQDAHELFHVITSSLEDERDRQPRVTHLFDVH

Postać fizyczna

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): nwg
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable