SAB2109030

Anti-IAPP (N-terminal) antibody produced in rabbit

affinity isolated antibody

• Synonim(y): AMYLIN, DAP, IAP
• Kod UNSPSC: 12352203
• NACRES: NA.43

Właściwości

• pochodzenie biologiczne: rabbit
• białko sprzężone: unconjugated
• forma przeciwciała: affinity isolated antibody
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• Postać: buffered aqueous solution
• masa cząsteczkowa: 4 kDa
• reaktywność gatunkowa (przewidywana na podstawie homologii): canine, rabbit, bovine, horse, human
• stężenie: 0.5 mg/mL
• metody: western blot: 1 μg/mL
• numer dostępu NCBI: NM_000415
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... IAPP(57396)

Opis

Opis ogólny

Islet, or insulinoma, amyloid polypeptide is commonly found in pancreatic islets of patients suffering diabetes mellitus type II, or harboring an insulinoma. While the assosciation of amylin with the development of type II diabetes has been known for some time, a direct causative role for amylin has been harder to establish. Studies suggest that amylin, like the related beta-amyloid (Abeta) associated with Alzheimer′s disease, can induce apoptotic cell-death in particular cultured cells, an effect that may be relevant to the development of type II diabetes.

Immunogen

Synthetic peptide directed towards the N terminal region of human IAPP

Sekwencja

Synthetic peptide located within the following region: MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQRLANFLV

Postać fizyczna

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): nwg
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable