SAB1405228

Monoclonal Anti-HAMP, (C-terminal) antibody produced in mouse

clone 1F9, purified immunoglobulin, buffered aqueous solution

• Synonim(y): HEPC, HEPCIDIN, HFE2B, LEAP-1, LEAP1, PLTR
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: mouse
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: purified immunoglobulin
• rodzaj przeciwciała: primary antibodies
• klon: 1F9, monoclonal
• Formularz: buffered aqueous solution
• masa cząsteczkowa: antigen ~32.71 kDa
• reaktywność gatunkowa: human
• metody: capture ELISA: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• izotyp: IgG1κ
• numer dostępu NCBI: BC020612
• numer dostępu UniProt: P81172
• Warunki transportu: dry ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... HAMP(57817)

Opis

Opis ogólny

The product encoded by this gene is involved in the maintenance of iron homeostasis, and it is necessary for the regulation of iron storage in macrophages, and for intestinal iron absorption. The preproprotein is post-translationally cleaved into mature peptides of 20, 22 and 25 amino acids, and these active peptides are rich in cysteines, which form intramolecular bonds that stabilize their beta-sheet structures. These peptides exhibit antimicrobial activity. Mutations in this gene cause hemochromatosis type 2B, also known as juvenile hemochromatosis, a disease caused by severe iron overload that results in cardiomyopathy, cirrhosis, and endocrine failure. (provided by RefSeq)

Immunogen

HAMP (AAH20612, 25 a.a. ~ 84 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SVFPQQTGQLAELQPQDRAGARASWMPMFQRRRRRDTHFPICIFCCGCCHRSKCGMCCKT

Postać fizyczna

Solution in phosphate buffered saline, pH 7.4

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 1
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable