SAB1403537

Monoclonal Anti-AK1 antibody produced in mouse

clone M1, purified immunoglobulin, buffered aqueous solution

• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: mouse
• białko sprzężone: unconjugated
• forma przeciwciała: purified immunoglobulin
• rodzaj przeciwciała: primary antibodies
• klon: M1, monoclonal
• Postać: buffered aqueous solution
• masa cząsteczkowa: antigen ~47.45 kDa
• reaktywność gatunkowa: human
• metody: capture ELISA: suitable; indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL
• izotyp: IgG1κ
• numer dostępu NCBI: BC001116
• numer dostępu UniProt: P00568
• Warunki transportu: dry ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... AK1(203)

Opis

Opis ogólny

Adenylate kinase is an enzyme involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate group among adinine nucleotides. Three isozymes of adenylate kinase have been identified in vertebrates, adenylate isozyme 1 (AK1), 2 (AK2) and 3 (AK3). AK1 is found in the cytosol of skeletal muscle, brain and erythrocytes, whereas AK2 and AK3 are found in the mitochondria of other tissues including liver and heart. AK1 was identified because of its association with a rare genetic disorder causing nonspherocytic hemolytic anemia where a mutation in the AK1 gene was found to reduce the catalytic activity of the enzyme. (provided by RefSeq)

Immunogen

AK1 (AAH01116, 1 a.a. ~ 194 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MEEKLKKTNIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTHLDALK

Postać fizyczna

Solution in phosphate buffered saline, pH 7.4

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 1
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable