Przejdź do zawartości
Merck
Wszystkie zdjęcia(2)

Dokumenty

SAB1402978

Sigma-Aldrich

Monoclonal Anti-MLL2 antibody produced in mouse

clone 2E1, purified immunoglobulin, buffered aqueous solution

Synonim(y):

AAD10, ALR, CAGL114, MLL4, TNRC21, Anti-AAD10, Anti-ALL1-related protein, Anti-ALR, Anti-CAGL114, Anti-Histone-lysine N-methyltransferase, Anti-KMS, Anti-KMT2B, Anti-KMT2D, Anti-Kabuki make-up syndrome, Anti-Kabuki mental retardation syndrome, Anti-MLL4, Anti-Myeloid/lymphoid or mixed-lineage leukemia 2, Anti-TNRC21

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych
Wszystkie zdjęcia(2)

About This Item

Kod UNSPSC:
12352203
NACRES:
NA.41

pochodzenie biologiczne

mouse

białko sprzężone

unconjugated

forma przeciwciała

purified immunoglobulin

rodzaj przeciwciała

primary antibodies

klon

2E1, monoclonal

Postać

buffered aqueous solution

masa cząsteczkowa

antigen ~37.11 kDa

reaktywność gatunkowa

human

metody

indirect ELISA: suitable
western blot: 1-5 μg/mL

izotyp

IgG2aκ

numer dostępu NCBI

NM_003482

Warunki transportu

dry ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... MLL2(8085)

Szukasz podobnych produktów? Odwiedź Przewodnik dotyczący porównywania produktów

Opis ogólny

Mixed-lineage leukemia 2 (MLL2), a histone methyltransferase that belongs to the trithorax group, is expressed ubiquitously in adult tissues. Structurally, MLL2 comprises plant homeodomain (PHD), Su(var)3-9, Enhancer-of-zeste and Trithorax (SET) domain, and a high mobility group (HMG) box. The MLL2 gene is mapped to human chromosome 12q13.12.

Immunogen

MLL2 (NP_003473.1, 1487 a.a. ~ 1586 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SKLEGMFPAYLQEAFFGKELLDLSRKALFAVGVGRPSFGLGTPKAKGDGGSERKELPTSQKGDDGPDIADEESRGLEGKADTPGPEDGGVKASPVPSDPE

Działania biochem./fizjol.

Mixed-lineage leukemia 2 (MLL2) regulates the expression of homeobox (Hox) genes. Mutations or haploinsufficiency in the MML2 gene is implicated in Kabuki syndrome, a multi-systemic disorder. It carries out methylation on the lysine 4 of histone H3 (H3K4). MLL2 plays a tumor suppressor role in Merkel cell carcinoma.

Postać fizyczna

Solution in phosphate buffered saline, pH 7.4

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
This page may contain text that has been machine translated.

Not finding the right product?  

Try our Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 1

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable

Certyfikaty analizy (CoA)

Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

Reety Arora et al.
Viruses, 12(9) (2020-09-04)
Merkel cell carcinoma (MCC) is an uncommon, lethal cancer of the skin caused by either Merkel cell polyomavirus (MCPyV) or UV-linked mutations. MCPyV is found integrated into MCC tumor genomes, accompanied by truncation mutations that render the MCPyV large T
N Bögershausen et al.
Clinical genetics, 83(3), 212-214 (2012-11-08)
To unravel the system of epigenetic control of transcriptional regulation is a fascinating and important scientific pursuit. Surprisingly, recent successes in gene identification using high-throughput sequencing strategies showed that, despite their ubiquitous role in transcriptional control, dysfunction of chromatin-modifying enzymes
Alessandra Fasciani et al.
Nature genetics, 52(12), 1397-1411 (2020-11-11)
The genetic elements required to tune gene expression are partitioned in active and repressive nuclear condensates. Chromatin compartments include transcriptional clusters whose dynamic establishment and functioning depend on multivalent interactions occurring among transcription factors, cofactors and basal transcriptional machinery. However
Young-Wook Cho et al.
The Journal of biological chemistry, 282(28), 20395-20406 (2007-05-15)
PTIP, a protein with tandem BRCT domains, has been implicated in DNA damage response. However, its normal cellular functions remain unclear. Here we show that while ectopically expressed PTIP is capable of interacting with DNA damage response proteins including 53BP1

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej