AV39390

Anti-METTL3 (AB2) antibody produced in rabbit

IgG fraction of antiserum

• Synonim(y): Anti-Methyltransferase like 3
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: IgG fraction of antiserum
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• Postać: buffered aqueous solution
• masa cząsteczkowa: 64 kDa
• reaktywność gatunkowa: mouse, rabbit, dog, rat, guinea pig, human, bovine, horse
• stężenie: 0.5 mg - 1 mg/mL
• metody: immunohistochemistry: suitable; western blot: suitable
• numer dostępu NCBI: NP_062826
• numer dostępu UniProt: Q86U44
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... METTL3(56339)

Opis

Opis ogólny

Methyltransferase like 3 (METTL3 or M6A) codes for a 70 kDa subunit of MT-A. This protein forms a heterodimeric complex with METTL14 and subsequently modulates the methylation of the mammalian nuclear RNA, N6-adenosine.
Rabbit Anti-METTL3 antibody recognizes bovine, canine, human, mouse, rat, and zebrafish METTL3.

Immunogen

Synthetic peptide directed towards the N terminal region of human METTL3

Zastosowanie

Rabbit Anti-METTL3 antibody is suitable for use in western blot (5 μg/ml) and IHC (4-8 μg/ml) applications.

Działania biochem./fizjol.

METTL3 is the 70 kDa subunit of MT-A which is part of N6-adenosine-methyltransferase. This enzyme is involved in the posttranscriptional methylation of internal adenosine residues in eukaryotic mRNAs, forming N6-methyladenosine.This gene encodes the 70 kDa subunit of MT-A which is part of N6-adenosine-methyltransferase. This enzyme is involved in the posttranscriptional methylation of internal adenosine residues in eukaryotic mRNAs, forming N6-methyladenosine.

Sekwencja

Synthetic peptide located within the following region: MSDTWSSIQAHKKQLDSLRERLQRRRKQDSGHLDLRNPEAALSPTFRSDS

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 1
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable