AV34910

Anti-CHRNA1 (AB2) antibody produced in rabbit

affinity isolated antibody

• Synonim(y): Anti-Cholinergic receptor, nicotinic, α-1 (muscle)
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: affinity isolated antibody
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• Postać: buffered aqueous solution
• masa cząsteczkowa: 52 kDa
• reaktywność gatunkowa: human, guinea pig, bovine, horse, mouse, dog, rat, rabbit
• stężenie: 0.5 mg - 1 mg/mL
• metody: western blot: suitable
• numer dostępu NCBI: NP_000070
• numer dostępu UniProt: Q53SH4
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... CHRNA1(1134)

Opis

Opis ogólny

CHRNA1 encodes the α subunit of the muscle acetylcholine receptor and is involved in acetyl choline binding and channel gating functions. The expression of CHRNA1 in thymus tissues is controlled by IRF8 and AIRE.
Rabbit Anti-CHRNA1 recognizes mouse, bovine, canine, and human CHRNA1.

Immunogen

Synthetic peptide directed towards the N terminal region of human CHRNA1

Zastosowanie

Rabbit Anti-CHRNA1 is suitable for western blot applications at a concentration of 0.5 μg/ml.

Działania biochem./fizjol.

The muscle acetylcholine receptor consiststs of 5 subunits of 4 different types: 2 alpha isoforms and 1 each of beta, gamma, and delta subunits.2 The CHRNA1 gene encodes an alpha subunit that plays a role in acetlycholine binding/channel gating.

Sekwencja

Synthetic peptide located within the following region: AGLVLGSEHETRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQLINVD

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 2
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable