AV40585

Anti-HNRPDL antibody produced in rabbit

IgG fraction of antiserum

• Sinónimos: Anti-Heterogeneous Nuclear Ribonucleoprotein D-like
• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: IgG fraction of antiserum
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 40 kDa
• species reactivity: guinea pig, mouse, horse, rat, human, bovine, dog
• concentration: 0.5 mg - 1 mg/mL
• technique(s): immunohistochemistry: suitable; western blot: suitable
• NCBI accession no.: NP_112740
• UniProt accession no.: O14979
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... HNRPDL(9987)

Descripción

General description

Heterogeneous Nuclear Ribonucleoproteins (hnRNP) are RNA binding proteins that form complexes with heterogeneous nuclear RNA (hnRNA). HnRNPs regulate pre-mRNA processing, metabolism and nuclear cytoplasmic shuttling. Specific HnRNPs have unique nucleic acid binding properties. Heterogeneous Nuclear Ribonucleoprotein D-like (JKTBP) is a DNA- and RNA-binding protein highly expressed in brain and testes tissue. JKTBP interacts with APP (β-amyloid precursor protein) creating a possible link between JKTBP and Alzheimer′s disease.

Specificity

Anti-HNRPDL (JKTBP) polyclonal antibody reacts with canine, zebrafish, human, chicken, rat, bovine, and mouse heterogeneous nuclear ribonucleoprotein D-like proteins.

Immunogen

Synthetic peptide directed towards the middle region of human HNRPDL

Application

Anti-HNRPDL (JKTBP) polyclonal antibody is used to tag the heterogeneous nuclear ribonucleoprotein D-like for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of heterogeneous nuclear ribonucleoprotein D-like in specific mRNA shuttling and Alzheimer′s disease.

Biochem/physiol Actions

HNRPDL belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. HNRPDL has two RRM domains that bind to RNAs.

Sequence

Synthetic peptide located within the following region: TMEDMNEYSNIEEFAEGSKINASKNQQDDGKMFIGGLSWDTSKKDLTEYL

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable