Saltar al contenido
Merck
Todas las fotos(7)

Key Documents

HPA035248

Sigma-Aldrich

Anti-IDH1 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinónimos:

Idh1 Antibody, Idh1 Antibody - Anti-IDH1 antibody produced in rabbit, Anti-isocitrate dehydrogenase 1 (NADP+), soluble

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human, mouse, rat

enhanced validation

RNAi knockdown
orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:500-1:1000

immunogen sequence

FVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAMGMYNQDKSIEDFAHSSFQMALSKGWPLY

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... IDH1(3417)

General description

1DH1 has a C-terminal peroxisomal targeting sequence and has two Rossmann fold units. It also possesses α /β sandwich structure and clasp domain further taking up staked parallel β-sheets fold.
The gene IDH1 (isocitrate dehydrogenase (NADP) 1 cytosolic) is mapped to human chromosome 2q33. The protein is present in the cytoplasm and peroxisomes.

Immunogen

isocitrate dehydrogenase 1 (NADP+), soluble recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-IDH1 antibody produced in rabbit has been used in western blotting.
Anti-IDH1 antibody produced in rabbit has been used in immunohistochemistry.

Biochem/physiol Actions

IDH1 (isocitrate dehydrogenase (NADP) 1 cytosolic) participates in the TCA (tricarboxylic acid) cycle. It is responsible for the formation of α-ketoglutarate (αKG) by oxidative decarboxylation of isocitrate, thereby resulting in the generation of NADPH (nicotinamide adenine dinucleotide phosphate). IDH1 helps in glucose sensing, glutamine metabolism, lipogenesis and controlling cellular redox condition. In presence of hypoxia, it results in reductive carboxylation of αKG to form acetyl-CoA, which is needed for lipid synthesis. In mouse model, overexpression of the IDH1 gene causes obesity, fatty liver and hyperlipidemia. Mutations in this gene are associated with glioblastoma multiforme and acute myeloid leukemia.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST79089

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable


Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Metformin sensitizes endometrial cancer cells to chemotherapy through IDH1-induced Nrf2 expression via an epigenetic mechanism
Bai M, et al.
Oncogene, 37(42), 5666-5681 (2018)
Sanne A M van Lith et al.
Scientific reports, 6, 30486-30486 (2016-07-28)
The majority of low-grade and secondary high-grade gliomas carry heterozygous hotspot mutations in cytosolic isocitrate dehydrogenase 1 (IDH1) or the mitochondrial variant IDH2. These mutations mostly involve Arg132 in IDH1, and Arg172 or Arg140 in IDH2. Whereas IDHs convert isocitrate
Structures of human cytosolic NADP-dependent isocitrate dehydrogenase reveal a novel self-regulatory mechanism of activity
Xu X, et al.
The Journal of Biological Chemistry, 279(32), 33946-33957 (2004)
Isocitrate dehydrogenase mutations in gliomas.
Waitkus MS, et al.
Neuro-Oncology, 18, 16-26 (2016)
Do Long-Term Survivor Primary Glioblastoma Patients Harbor IDH1 Mutations?
Sarmiento JM, et al.
Journal of Neurological Surgery. Part A, Central European Neurosurgery, 77, 195-200 (2016)

Artículos

Fatty acid synthesis supports cancer cell proliferation, essential for membrane generation, protein modification, and bioenergetics.

Fatty acid synthesis supports cancer cell proliferation, essential for membrane generation, protein modification, and bioenergetics.

Fatty acid synthesis supports cancer cell proliferation, essential for membrane generation, protein modification, and bioenergetics.

Fatty acid synthesis supports cancer cell proliferation, essential for membrane generation, protein modification, and bioenergetics.

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico