Skip to Content
Merck
All Photos(3)

Key Documents

HPA006404

Sigma-Aldrich

Anti-TNFRSF14 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-Herpesvirus entry mediator A, Anti-TR2, Anti-Tumor necrosis factor receptor superfamily member 14 precursor, Anti-Tumor necrosis factor receptor-like 2

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
NOK 4,250.00

NOK 4,250.00


Please contact Customer Service for Availability


Select a Size

Change View
100 μL
NOK 4,250.00

About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41
conjugate:
unconjugated
application:
IF
IHC
clone:
polyclonal
species reactivity:
human
citations:
3
technique(s):
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:20-1:50

NOK 4,250.00


Please contact Customer Service for Availability

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:20-1:50

immunogen sequence

PPGDWGPPPWRSTPKTDVLRLVLYLTFLGAPCYAPALPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCD

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... TNFRSF14(8764)

General description

TNFRSF14 (tumor necrosis factor receptor superfamily, member 14) gene is localized to human chromosome 1p36.22-36.3, which contains other TNFR superfamily members. The encoded product is a single transmembrane protein composed of 283 amino acid residues. This protein is made up of a leader peptide of 36 amino acids, four TNFR-like cysteine-rich domains of which two are perfect and two are imperfect, and a small cytosolic tail. The mRNA has a wide range of tissue expression, with constitutive and predominant expression in monocytes, B and T cells. The putative molecular weight of this protein is 28kDa.

Immunogen

Tumor necrosis factor receptor superfamily member 14 precursor recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

TNFRSF14 (tumor necrosis factor receptor superfamily, member 14), along with its ligand, is thought to be involved in T-cell activation and proliferation. It acts as a regulator of immunological processes, and is aberrantly expressed in multiple cancers. It confers protection to cancer cells from host autoimmune mechanisms. It is linked to human esophageal squamous cell carcinoma, and might have potential as a therapeutic target for the same. It also plays a part in the pathogenesis of inflammatory and autoimmune disorders. Studies in Chinese population show that variants of this gene are linked to risk of sporadic breast cancer.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST70335

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Dalin Li et al.
PloS one, 8(8), e71040-e71040 (2013-08-27)
As a costimulatory molecule, Herpesvirus entry mediator (HVEM) can bind with several costimulatory members, thus HVEM plays different roles in T cell immunity. HVEM and its ligands have been involved in the pathogenesis of various autoimmune, inflammatory diseases and tumors.
Kazuhiro Migita et al.
Cancer, 120(6), 808-817 (2013-11-20)
Herpesvirus entry mediator (HVEM) is known to regulate immune response and to be expressed in several human malignancies. However, to the authors's knowledge, the precise role of HVEM in human cancer biology remains unknown. The objective of the current study
B S Kwon et al.
The Journal of biological chemistry, 272(22), 14272-14276 (1997-05-30)
The tumor necrosis factor receptor (TNFR) superfamily consists of approximately 10 characterized members of human proteins. We have identified a new member of the TNFR superfamily, TR2, from a search of an expressed sequence tag data base. cDNA cloning and

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service