WH0051435M1
Monoclonal Anti-SCARA3 antibody produced in mouse
clone 3A2, purified immunoglobulin, buffered aqueous solution
Synonym(s):
Anti-APC7, Anti-CSR, Anti-CSR1, Anti-MSLR1, Anti-MSRL1, Anti-scavenger receptor class A, member 3
Sign Into View Organizational & Contract Pricing
All Photos(6)
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
biological source
mouse
conjugate
unconjugated
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
3A2, monoclonal
form
buffered aqueous solution
species reactivity
rat, human, mouse
technique(s)
indirect ELISA: suitable
western blot: 1-5 μg/mL
isotype
IgG2aκ
GenBank accession no.
UniProt accession no.
shipped in
dry ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... SCARA3(51435)
Related Categories
General description
This gene encodes a macrophage scavenger receptor-like protein. This protein has been shown to deplete reactive oxygen species, and thus play an important role in protecting cells from oxidative stress. The expression of this gene is induced by oxidative stress. Alternatively spliced transcript variants encoding distinct isoforms have been described. (provided by RefSeq)
Immunogen
SCARA3 (NP_057324, 316 a.a. ~ 415 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SFLDDHEENMHDLQYHTHYAQNRTVERFESLEGRMASHEIEIGTIFTNINATDNHVHSMLKYLDDVRLSCTLGFHTHAEELYYLNKSVSIMLGTTDLLRE
Sequence
SFLDDHEENMHDLQYHTHYAQNRTVERFESLEGRMASHEIEIGTIFTNINATDNHVHSMLKYLDDVRLSCTLGFHTHAEELYYLNKSVSIMLGTTDLLRE
Biochem/physiol Actions
Scavenger receptor class A member 3 (SCARA3) protects cells against ultraviolet (UV) irradiation and oxidative stress. Reduced expression of SCARA3 increases oxidative stress in keratoconus (KC) cells in vitro. Quantitative polymerase chain reaction (PCR) analysis proves that SCARA3 transcript is highly expressed in ovarian/primary peritoneal carcinoma (OC/PPC) compared to breast carcinoma effusions. SCARA3 represses tumor growth and metastasis of prostate cancer. Therefore, it can be used as a potential therapeutic target for treating aggressive types of prostate cancer.
Physical form
Solution in phosphate buffered saline, pH 7.4
Legal Information
GenBank is a registered trademark of United States Department of Health and Human Services
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
nwg
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Personal Protective Equipment
dust mask type N95 (US), Eyeshields, Gloves
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Charles O Brown et al.
Leukemia research, 37(8), 963-969 (2013-03-30)
This study evaluates the role of scavenger receptor class A member 3 (SCARA3) in multiple myeloma (MM). SCARA3 expression was induced upon treatment with oxidative stressors (ionizing radiation and chemotherapeutic drugs). An epigenetic inactivation of SCARA3 was noted in MM.1S
Guoying Yu et al.
The American journal of pathology, 168(2), 597-607 (2006-01-27)
Prostate cancer is frequent among men over 45 years of age, but it generally only becomes lethal with metastasis. In this study, we identified a gene called cellular stress response 1 (CSR1) that was frequently down-regulated and methylated in prostate
Downregulation of SCARA3, CPSF3 and FOXM1 in Keratoconus Cells in vitro
CM Kenney
Investigative Ophthalmology & Visual Science, 53, 1112-1112 (2012)
Annika J Bock et al.
Human pathology, 43(5), 669-674 (2011-08-23)
Scavenger receptor class A, member 3 (SCARA3) was previously found to be overexpressed in ovarian/primary peritoneal carcinoma (OC/PPC) compared with breast carcinoma effusions by global gene expression analysis. The present study aimed to validate this finding applying quantitative PCR and
H J Han et al.
Human molecular genetics, 7(6), 1039-1046 (1998-06-13)
Oxidative stress is a pathogenic condition that causes cellular damage and, in a normally functioning cell, several transcription factors respond to this threat by modulating expression of genes whose products ameliorate the altered redox status in some way. We have
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service