Skip to Content
Merck
All Photos(3)

Key Documents

SAB1403654

Sigma-Aldrich

Monoclonal Anti-CDH17 antibody produced in mouse

clone 3H2, purified immunoglobulin, buffered aqueous solution

Synonym(s):

CDH16, FLJ26931, HPT-1, HPT1, MGC138218, MGC142024

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

3H2, monoclonal

form

buffered aqueous solution

mol wt

antigen ~37.99 kDa

species reactivity

human

technique(s)

ELISA: suitable
capture ELISA: suitable
immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
western blot: 1-5 μg/mL

isotype

IgG1κ

NCBI accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... CDH17(1015)

General description

This gene is a member of the cadherin superfamily, genes encoding calcium-dependent, membrane-associated glycoproteins. The encoded protein is cadherin-like, consisting of an extracellular region, containing 7 cadherin domains, and a transmembrane region but lacking the conserved cytoplasmic domain. The protein is a component of the gastrointestinal tract and pancreatic ducts, acting as an intestinal proton-dependent peptide transporter in the first step in oral absorption of many medically important peptide-based drugs. The protein may also play a role in the morphological organization of liver and intestine. Alternative splicing results in multiple transcript variants. (provided by RefSeq)

Immunogen

CDH17 (NP_004054, 24 a.a. ~ 131 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
EGKFSGPLKPMTFSIYEGQEPSQIIFQFKANPPAVTFELTGETDNIFVIEREGLLYYNRALDRETRSTHNLQVAALDANGIIVEGPVPITIEVKDINDNRPTFLQSKY

Biochem/physiol Actions

The protein encoded by the gene CDH17 (Cadherin-17), also referred to as LI-cadherin, functions in cell adhesion without being dependent on cytoplasmic components, such as catenins or the actin cytoskeleton. Lower expression of this protein due to single nucleotide polymorphisms has been associated with tumor progression and lymph node metastasis of human colorectal carcinoma. It is found to regulate the signaling function of α2β1 integrin in cell adhesion and proliferation in liver metastatic cancer cells.

Physical form

Solution in phosphate buffered saline, pH 7.4

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

R A Bartolomé et al.
Oncogene, 33(13), 1658-1669 (2013-04-23)
Liver metastasis is the major cause of death associated to colorectal cancer. Cadherin-17 (CDH17) is a non-classical, seven domain, cadherin lacking the conserved cytoplasmic domain of classical cadherins. CDH17 was overexpressed in highly metastatic human KM12SM and present in many
Single nucleotide polymorphisms in the CDH17 gene of colorectal carcinoma.
Chen RY
World Journal of Gastroenterology, 18, 7251-7261 (2012)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service