SAB5702094

Anti-Caveolin-1 Antibody, clone 10Y5L2, Rabbit Monoclonal

• Sinónimos: BSCL3,CGL3,LCCNS,MSTP085,PPH3,VIP21,CAV1
• UNSPSC Code: 12352203
• NACRES: NA.46

Propiedades

• biological source: rabbit
• Quality Level: 100
• material: colorless
• clone: 10Y5L2, monoclonal
• form: liquid
• species reactivity: human, rat, rat
• concentration: 1.00 mg/mL
• technique(s): immunohistochemistry: 1:50 - 1:200; western blot: 1:500 - 1:2000
• color: colorless
• isotype: IgG
• immunogen sequence: MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHS
• UniProt accession no.: Q03135
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... CAV1(857)

Descripción

General description

The scaffolding protein encoded by this gene is the main component of the caveolae plasma membranes found in most cell types. The protein links integrin subunits to the tyrosine kinase FYN, an initiating step in coupling integrins to the Ras-ERK pathway and promoting cell cycle progression. The gene is a tumor suppressor gene candidate and a negative regulator of the Ras-p42/44 mitogen-activated kinase cascade. Caveolin 1 and caveolin 2 are located next to each other on chromosome 7 and express colocalizing proteins that form a stable hetero-oligomeric complex. Mutations in this gene have been associated with Berardinelli-Seip congenital lipodystrophy. Alternatively spliced transcripts encode alpha and beta isoforms of caveolin 1.[provided by RefSeq, Mar 2010]

Immunogen

PBS with 0.05% proclin300,0.05% BSA,50% glycerol,pH7.3.

Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human Caveolin-1 (NP_001744.2).

Application

WB, IHC

Información de seguridad

• pictograms: GHS07,GHS09
• signalword: Warning
• hcodes: H317,H411
• pcodes: P261 - P272 - P273 - P280 - P302 + P352 - P333 + P313
• Hazard Classifications: Aquatic Chronic 2 - Skin Sens. 1
• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 3