SAB2101012

Anti-HAL antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-HIS, Anti-HSTD, Anti-Histidase, Anti-Histidine ammonia-lyase
• MDL number: MFCD02096540
• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 72 kDa
• species reactivity: rabbit, mouse, human, rat, bovine
• concentration: 0.5 mg - 1 mg/mL
• technique(s): immunohistochemistry: suitable; western blot: suitable
• UniProt accession no.: P42357
• shipped in: wet ice
• storage temp.: −20°C
• Gene Information: human ... HAL(3034)

Descripción

Immunogen

Synthetic peptide directed towards the N terminal region of human HAL

Biochem/physiol Actions

HAL is a cytosolic enzyme catalyzing the first reaction in histidine catabolism, the nonoxidative deamination of L-histidine to trans-urocanic acid. HAL defects cause histidinemia which is characterized by increased histidine and histamine and decreased urocanic acid in body fluids Histidine ammonia-lyase is a cytosolic enzyme catalyzing the first reaction in histidine catabolism, the nonoxidative deamination of L-histidine to trans-urocanic acid. Histidine ammonia-lyase defects cause histidinemia which is characterized by increased histidine and histamine and decreased urocanic acid in body fluids.

Sequence

Synthetic peptide located within the following region: INKLQELQVNLVRSHSSGVGKPLSPERCRMLLALRINVLAKGYSGISLET

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable