SAB1403291

Monoclonal Anti-CHST12 antibody produced in mouse

clone 3D6, purified immunoglobulin, buffered aqueous solution

• Sinónimos: C4S-2, C4ST-2, C4ST2
• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 3D6, monoclonal
• form: buffered aqueous solution
• mol wt: antigen ~36.56 kDa
• species reactivity: human
• technique(s): capture ELISA: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG2aκ
• NCBI accession no.: NM_018641
• UniProt accession no.: Q9NRB3
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... CHST12(55501)

Descripción

General description

Chondroitin 4-sulfotransferases, such as CHST12, add sulfate to position 4 of N-acetylgalactosamine residues in chondroitin (Hiraoka et al., 2000 [PubMed 10781601]).[supplied by OMIM

Immunogen

CHST12 (NP_061111.1, 56 a.a. ~ 150 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
RDRELTADSDVDEFLDKFLSAGVKQSDLPRKETEQPPAPGSMEESVRGYDWSPRDARRSPDQGRQQAERRSVLRGFCANSSLAFPTKERAFDDIP

Physical form

Solution in phosphate buffered saline, pH 7.4

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable