Skip to Content
MilliporeSigma
All Photos(2)

Key Documents

AV38038

Sigma-Aldrich

Anti-FOXJ1 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-FKHL13, Anti-Forkhead box J1, Anti-HFH-4, Anti-HFH4, Anti-MGC35202

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

45 kDa

species reactivity

dog, sheep, human, pig, bovine

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... FOXJ1(2302)

Immunogen

Synthetic peptide directed towards the N terminal region of human FOXJ1

Biochem/physiol Actions

FOXJ1 is a member of forkhead/winged-helix transcription factor family, which play crucial roles during vertebrate development. FOXJ1 may play an important role in cell fate determination during lung development and in spermatogenesis.The unique pattern of FOXJ1expression during human fetal development suggests a role for this forkhead/winged-helix factor during pulmonary and renal epithelial development. Single nucleotide polymorphisms were identified in FOXJ1 and a significant association was found with allergic rhinitis.FOXJ1 is a member of the forkhead gene family, which was originally identified in Drosophila. The forkhead family is composed of transcription factors with a conserved 100-amino acid DNA-binding motif.FOXJ1 is a member of the forkhead gene family, which was originally identified in Drosophila. The forkhead family is composed of transcription factors with a conserved 100-amino acid DNA-binding motif.[supplied by OMIM].

Sequence

Synthetic peptide located within the following region: MAESWLRLSGAGPAEEAGPEGGLEEPDALDDSLTSLQWLQEFSILNAKAP

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 2

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Allison M Greaney et al.
Cell reports, 30(12), 4250-4265 (2020-03-27)
Cell-based therapies have shown promise for treating myriad chronic pulmonary diseases through direct application of epithelial progenitors or by way of engineered tissue grafts or whole organs. To elucidate environmental effects on epithelial regenerative outcomes in vitro, here, we isolate and

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service