WH0256297M5

Monoclonal Anti-PTF1A antibody produced in mouse

clone 1A2, purified immunoglobulin, buffered aqueous solution

• Synonym(s): Anti-PTF1p48, Anti-pancreas specific transcription factor, 1a
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 1A2, monoclonal
• form: buffered aqueous solution
• species reactivity: human
• technique(s): immunofluorescence: suitable; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG2a
• GenBank accession no.: NM_178161
• UniProt accession no.: Q7RTS3
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... PTF1A(256297)

Description

General description

This gene encodes a protein that is a component of the pancreas transcription factor 1 complex (PTF1) and is known to have a role in mammalian pancreatic development. The protein plays a role in determining whether cells allocated to the pancreatic buds continue towards pancreatic organogenesis or revert back to duodenal fates. The protein is thought to be involved in the maintenance of exocrine pancreas-specific gene expression including elastase 1 and amylase. Mutations in this gene cause cerebellar agenesis and loss of expression is seen in ductal type pancreas cancers. (provided by RefSeq)

Immunogen

PTF1A (NP_835455, 250 a.a. ~ 328 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
QAQKVIICHRGTRSPSPSDPDYGLPPLAGHSLSWTDEKQLKEQNIIRTAKVWTPEDPRKLNSKSSFNNIENEPPFEFVS

Biochem/physiol Actions

Pancreas specific transcription factor, 1A (PTF1A) aids in the growth and differentiation of pancreas. It also has a control over excitatory and inhibitory neurons in the brain. Mutations in the PTF1A gene have been linked to cerebellar agenesis.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: nwg
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable
• Personal Protective Equipment: dust mask type N95 (US), Eyeshields, Gloves