HPA010928
Anti-SFTPC antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab1
Synonym(s):
Anti-BRICD6, Anti-PSP-C, Anti-SFTP2, Anti-SMDP2, Anti-SP-C
Sign Into View Organizational & Contract Pricing
All Photos(4)
About This Item
Recommended Products
biological source
rabbit
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
enhanced validation
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:2500-1:5000
immunogen sequence
PEAQQRLALSEHLVTTATFSIGSTGLVVYDYQQLLIAYKPAPGTCCYIMKIAPESIPSLEALTRKVHNFQAKPAVPTSKLGQAEGRDAGSAPSGGDPAFLGMAVSTLCG
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... SFTPC(6440)
Related Categories
General description
Pulmonary surfactant is a mixture of phospholipids and protein, which is surface-active and secreted by type II epithelial cells into the alveolar space. There are four proteins present in the surfactant namely, SP (surfactant protein)-A, SP-B, SP-C or SFTPC and SP-D. SFTPC is a hydrophobic protein, which is produced as a proprotein and undergoes post-translational modification to have its NH2 and COOH propeptides removed. The mature active protein has a molecular weight of 3.7kDa. The proprotein is composed of 197 amino acids and is produced exclusively by alveolar type 2 (AT2) cells. SFTPC contains BRICHOS domain, which is suggested to prevent the aggregation of the peptide and regulate proteolytic processing of SFTPC proprotein. This gene is located on human chromosome 8p21.
Immunogen
Pulmonary surfactant-associated protein C Precursor recombinant protein epitope signature tag (PrEST)
Application
Anti-SFTPC antibody produced in rabbit has been used in immunohistochemistry (IHC) and immunofluorescence (IF).
Biochem/physiol Actions
SFTPC (surfactant protein C) stabilizes the pulmonary surfactant film and aids in the adsorption of phospholipids on the surfactant monolayer. This way it regulates the metabolism and dynamics of the phospholipids constituting pulmonary surfactant. Mutations in this gene are associated with interstitial lung disease (ILD) in infants. Mutations in SFTPC can lead to various disorders such as, chronic pneumonitis in infants, and usual or desquamative interstitial pneumonia and idiopathic pulmonary fibrosis in adults. G100S mutation in the BRICHOS domain of SFTPC proprotein, leads to increased endoplasmic reticulum (ER) stress and cell apoptosis. Therefore, G100S mutation in this gene is involved in the pathogenesis of familial pulmonary fibrosis in Japanese population. Mutations in SFTPC gene also result in combined pulmonary fibrosis and emphysema (CPFE) syndrome, which is characterized by emphysema, inflammation and fibrosis.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Linkage
Corresponding Antigen APREST72206
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Recombinant BRICHOS chaperone domains delivered to mouse brain parenchyma by focused ultrasound and microbubbles are internalized by hippocampal and cortical neurons
Galan-Acosta L, et al.
Molecular and Cellular Neurosciences, 103498-103498 (2020)
Christoph H Mayr et al.
EMBO molecular medicine, 13(4), e12871-e12871 (2021-03-03)
The correspondence of cell state changes in diseased organs to peripheral protein signatures is currently unknown. Here, we generated and integrated single-cell transcriptomic and proteomic data from multiple large pulmonary fibrosis patient cohorts. Integration of 233,638 single-cell transcriptomes (n = 61) across
Paul A Stevens et al.
Pediatric research, 57(1), 89-98 (2004-11-24)
Human surfactant protein C (hSP-C(1-197)) is synthesized as a 197 amino acid proprotein and cleaved to a mature 3.7 kD form. Although interstitial lung disease in patients with mutations of the hSP-C gene is becoming increasingly recognized, the mechanisms linking
Recapitulating idiopathic pulmonary fibrosis related alveolar epithelial dysfunction in a human iPSC-derived air-liquid interface model
Schruf E, et al.
Faseb Journal, 103498-103498 (2020)
Variable phenotype associated with SP-C gene mutations: fatal case with the I73T mutation.
S Percopo et al.
The European respiratory journal, 24(6), 1072-1073 (2004-12-02)
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service