Skip to Content
Merck
All Photos(3)

Key Documents

SAB1400208

Sigma-Aldrich

Anti-SLC25A3 antibody produced in mouse

IgG fraction of antiserum, buffered aqueous solution

Synonym(s):

Anti-OK/SW-cl.48, Anti-PHC

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

immunofluorescence: suitable
western blot: 1 μg/mL

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... SLC25A3(5250)

General description

Solute carrier family 25 member 3 (SLC25A3) gene codes for mitochondrial phosphate carrier (PiC) protein. SLC25A3/ PiC protein belongs to the mitochondrial-carrier family. PiC consists of six transmembrane segments, 3-fold symmetry, and an N and C termini. The SLC25A3 gene is located on human chromosome 12q23.1.

Immunogen

SLC25A3 (NP_002626.1, 1 a.a. ~ 361 a.a) full-length human protein.

Sequence
MFSSVAHLARANPFNTPHLQLVHDGLGDLRSSSPGPTGQPRRPRNLAAAAVEEYSCEFGSAKYYALCGFGGVLSCGLTHTAVVPLDLVKCRMQVDPQKYKGIFNGFSVTLKEDGVRGLAKGWAPTFLGYSMQGLCKFGFYEVFKVLYSNMLGEENTYLWRTSLYLAASASAEFFADIALAPMEAAKVRIQTQPGYANTLRDAAPKMYKEEGLKAFYKGVAPLWMRQIPYTMMKFACFERTVEALYKFVVPKPRSECSKPEQLVVTFVAGYIAGVFCAIVSHPADSVVSVLNKEKGSSASLVLKRLGFKGVWKGLFARIIMIGTLTALQWFIYDSVKVYFRLPRPPPPEMPESLKKKLGLTQ

Application

Anti-SLC25A3 antibody produced in mouse has been used in immunoblotting.

Biochem/physiol Actions

Solute carrier family 25 member 3 (SLC25A3) helps in the transportation of inorganic phosphate into the mitochondrial matrix. Heterozygous mutations in the SLC25A3 gene might be related in vivo with respiratory distress and hypertrophic cardiomyopathy. Assays in Lactococcus lactis confirm the role of SLC25A3 as a copper transporter.

Physical form

Solution in phosphate buffered saline, pH 7.4

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Erin L Seifert et al.
The Journal of biological chemistry, 291(50), 26126-26137 (2016-10-27)
The relevance of mitochondrial phosphate carrier (PiC), encoded by SLC25A3, in bioenergetics is well accepted. However, little is known about the mechanisms mediating the cellular impairments induced by pathological SLC25A3 variants. To this end, we investigated the pathogenicity of a
Aren Boulet et al.
The Journal of biological chemistry, 293(6), 1887-1896 (2017-12-15)
Copper is required for the activity of cytochrome c oxidase (COX), the terminal electron-accepting complex of the mitochondrial respiratory chain. The likely source of copper used for COX biogenesis is a labile pool found in the mitochondrial matrix. In mammals
Johannes A Mayr et al.
American journal of human genetics, 80(3), 478-484 (2007-02-03)
The mitochondrial phosphate carrier SLC25A3 transports inorganic phosphate into the mitochondrial matrix, which is essential for the aerobic synthesis of adenosine triphosphate (ATP). We identified a homozygous mutation--c.215G-->A (p.Gly72Glu)--in the alternatively spliced exon 3A of this enzyme in two siblings

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service