Skip to Content
Merck
All Photos(7)

Key Documents

HPA027524

Sigma-Aldrich

Anti-ZEB1 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-AREB6, Anti-BZP, Anti-FECD6, Anti-NIL-2-A, Anti-PPCD3, Anti-TCF8, Anti-ZEB, Anti-Zfhep, Anti-Zfhx1a, Zeb1 Antibody, Zeb1 Antibody - Anti-ZEB1 antibody produced in rabbit

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.43

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:500-1:1000

immunogen sequence

EAEKPESSVSSATGDGNLSPSQPPLKNLLSLLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQAGQISVQSSEPSSPEPGKVNIPAKNNDQPQSANANEPQDSTVNLQSPLKMTNSPVLPVGST

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... ZEB1(6935)

Immunogen

Zinc finger E-box-binding homeobox 1 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-ZEB1 antibody produced in rabbit has been used in western blotting, chromatin immunoprecipitation, immunohistochemistry and immunofluorescence.

Biochem/physiol Actions

ZEB1 (zinc finger E-box-binding homeobox 1) is an EMT (epithelial-mesenchymal transition) transcription factor and controls the expression of E-cadherin. It works as a repressor for E-cadherin and thereby induces EMT. Thus, ZEB1 plays an important role in tumor invasion and metastasis. Epigenetic suppression of ZEB1 might be a useful tool for overcoming drug resistance in human breast cancer. Mutations in this gene are associated with posterior polymorphous corneal dystrophy and Fuchs′ endothelial corneal dystrophy (FECD6). The ZEB1 gene is mapped to human chromosome 10p11.2.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST84772

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

An hTERT/ZEB1 complex directly regulates E-cadherin to promote epithelial-to-mesenchymal transition (EMT) in colorectal cancer.
Qin Y, et al.
Oncotarget, 7, 351-361 (2016)
Evelyn Fessler et al.
EMBO molecular medicine, 8(7), 745-760 (2016-05-26)
The heterogeneous nature of colorectal cancer (CRC) complicates prognosis and is suggested to be a determining factor in the efficacy of adjuvant therapy for individual patients. Based on gene expression profiling, CRC is currently classified into four consensus molecular subtypes
Stefan Werner et al.
The Journal of biological chemistry, 288(32), 22993-23008 (2013-07-03)
Using a retrovirus-mediated cDNA expression cloning approach, we identified the grainyhead-like 2 (GRHL2) transcription factor as novel protooncogene. Overexpression of GRHL2 in NIH3T3 cells induced striking morphological changes, an increase in cell proliferation, anchorage-independent growth, and tumor growth in vivo.
Quantitative analysis of microRNAs in tissue microarrays by in situ hybridization.
Hanna JA, et al.
Biotechniques, 52, 235-245 (2012)
Mutational spectrum of the ZEB1 gene in corneal dystrophies supports a genotype-phenotype correlation.
Lechner J, et al.
Investigative Ophthalmology & Visual Science, 54, 3215-3223 (2013)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service