Skip to Content
Merck
All Photos(8)

Key Documents

AMAB91041

Sigma-Aldrich

Monoclonal Anti-VGLUT1 antibody produced in mouse

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, clone CL2754, purified immunoglobulin, buffered aqueous glycerol solution

Synonym(s):

BNPI, SLC17A7

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

CL2754, monoclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

mouse, human, rat

enhanced validation

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 1 μg/mL
immunohistochemistry: 1:5000- 1:10000

isotype

IgG2b

immunogen sequence

PSISEEERKYIEDAIGESAKLMNPLTKFSTP

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... VGLUT1(57030)

General description

Vesicular glutamate transporter 1 (VGLUT1), also called as solute carrier family 17 member 7
(SLC17A7), is encoded by the gene mapped to human chromosome 19q13, a region associated with schizophrenia. VGLUT1 is specifically expressed in neuronal cells in the brain and at higher level in neuron-enriched regions such as the amygdala and hippocampus. Glia-enriched areas such as the corpus callosum also show moderate level of expression and substantia nigra, subthalamic nuclei and thalamus show low level expression. VGLUT1 is characterized with a conserved C-terminal dileucine-like motif and two polyproline domains distal to C- terminal end, including one that binds to endocytic BAR (Bin/Amphiphysin/Rvs) domain protein, endophilin.

Immunogen

solute carrier family 17 member 7

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

Vesicular glutamate transporter 1 (VGLUT1) plays a vital role as an vesicular glutamate transporter in glutamatergic neurons. VGLUT1 expression in the prefrontal cortex, functions as a potential neurochemical marker of dementia in Alzheimer disease (AD) and antidepressant activity.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST70070

Physical form

40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

B Pomierny et al.
Neuromolecular medicine, 26(1), 35-35 (2024-08-24)
Glutamate (Glu) is a major excitatory neurotransmitter in the brain, essential for synaptic plasticity, neuronal activity, and memory formation. However, its dysregulation leads to excitotoxicity, implicated in neurodegenerative diseases and brain ischemia. Vesicular glutamate transporters (VGLUTs) regulate Glu loading into
Assignment of SLC17A6 (alias DNPI), the gene encoding brain/pancreatic islet-type Na+-dependent inorganic phosphate cotransporter to human chromosome 11p14. 3.
Aihara Y, et al.
Cytogenetic and genome research, 92(1-2), 167-169 (2001)
Jozef Mizera et al.
Nutrients, 14(11) (2022-06-11)
A high-calorie diet has contributed greatly to the prevalence of overweight and obesity worldwide for decades. These conditions also affect pregnant women and have a negative impact on the health of both the woman and the fetus. Numerous studies indicate
Selective cortical VGLUT1 increase as a marker for antidepressant activity.
Moutsimilli L, et al.
Neuropharmacology, 49(6), 890-900 (2005)
Molecular and functional analysis of a novel neuronal vesicular glutamate transporter.
Bai L, et al.
The Journal of Biological Chemistry, 276(39), 36764-36769 (2001)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service