WH0007291M1
Monoclonal Anti-TWIST1 antibody produced in mouse
clone 3E11, purified immunoglobulin, buffered aqueous solution
동의어(들):
Anti-ACS3, Anti-BPES2, Anti-BPES3, Anti-SCS, Anti-TWIST, Anti-twist homolog 1 (acrocephalosyndactyly 3; Saethre-Chotzen syndrome) (Drosophila)
로그인조직 및 계약 가격 보기
모든 사진(5)
About This Item
추천 제품
생물학적 소스
mouse
결합
unconjugated
항체 형태
purified immunoglobulin
항체 생산 유형
primary antibodies
클론
3E11, monoclonal
형태
buffered aqueous solution
종 반응성
human
기술
immunoprecipitation (IP): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL
동형
IgG1κ
GenBank 수납 번호
UniProt 수납 번호
배송 상태
dry ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... TWIST1(7291)
관련 카테고리
일반 설명
Twist family bHLH transcription factor 1 (TWIST1) is a basic helix-loop-helix transcription factor and the gene encoding it is localized on human chromosome 7p21.1.
면역원
TWIST1 (NP_000465, 100 a.a. ~ 202 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PQSYEELQTQRVMANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAFSVWRMEGAWSMSASH
Sequence
PQSYEELQTQRVMANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAFSVWRMEGAWSMSASH
생화학적/생리학적 작용
Twist family bHLH transcription factor 1 (TWIST1) has a role in the determination of cell lineage and differentiation during embryogenesis. During the development of neural crest, it is also involved in modulating cell movement and tissue reorganization. Mutations in the TWIST1 gene have been associated with Saethre-Chotzen syndrome (4) and the protein is also linked to various cancers.
물리적 형태
Solution in phosphate buffered saline, pH 7.4
법적 정보
GenBank is a registered trademark of United States Department of Health and Human Services
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our 제품 선택기 도구.
Storage Class Code
10 - Combustible liquids
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
개인 보호 장비
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
시험 성적서(COA)
제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.
MACC1 ? more than metastasis?
Facts and predictions about a novel gene
Facts and predictions about a novel gene
Ulrike Stein
Journal of Molecular Medicine (2010)
Prognostic and clinicopathological value of Twist expression in breast cancer: A meta-analysis.
Qiao W
PLoS ONE (2017)
Reactivation of TWIST1 contributes to Ewing sarcoma metastasis.
Pediatric Blood & Cancer (2018)
Saethre-Chotzen syndrome caused by TWIST 1 gene mutations: functional differentiation from Muenke coronal synostosis syndrome.
Kress W
European Journal of Human Genetics (2006)
Ping Fan et al.
European journal of cancer (Oxford, England : 1990), 50(2), 457-468 (2013-11-05)
Our publications demonstrate that physiological concentrations of oestrogen (E2) induce endoplasmic reticulum and oxidative stress which finally result in apoptosis in E2-deprived breast cancer cells, MCF-7:5C. c-Src is involved in the process of E2-induced stress. To mimic the clinical administration
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.