WH0001486M1

Monoclonal Anti-CTBS antibody produced in mouse

clone 1B5-1B9, purified immunoglobulin, buffered aqueous solution

• 동의어(들): Anti-CTB, Anti-chitobiase, di-N-acetyl-
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 1B5-1B9, monoclonal
• 형태: buffered aqueous solution
• 종 반응성: human
• 기술: indirect ELISA: suitable; western blot: 1-5 μg/mL
• 동형: IgG1κ
• GenBank 수납 번호: BC024007
• UniProt 수납 번호: Q01459
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... CTBS(1486)

설명

일반 설명

The gene CTBS (chitobiase) is mapped to human chromosome 1p22. The gene spans a length of approximately 20kb with seven exons interspaced by six introns. The 5′-flanking region of human chitobiase gene is rich in GC-content.

면역원

CTBS (AAH24007.2, 37 a.a. ~ 105 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
DCPCPEPELCRPIRHHPDFEVFVFDVGQKTWKSYDWSQITTVATFGKYDSELMCYAHSKGARVVLKGNL

생화학적/생리학적 작용

The gene CTBS (chitobiase) encodes a lysosomal glycosidase that functions in the degradation of asparagine-linked glycoproteins. It cleaves the reducing-end N-Acetylglucosamine residues from the chitobiose core of oligosaccharides.

물리적 형태

Solution in phosphate buffered saline, pH 7.4

법적 정보

GenBank is a registered trademark of United States Department of Health and Human Services

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable
• 개인 보호 장비: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)