SAB5702377

Anti-Laminin beta 1 (LAMB1) Antibody

rabbit monoclonal, 6I9T4

• 동의어(들): CLM, LIS5
• UNSPSC 코드: 12352203
• NACRES: NA.46

속성

• 제품명: Anti-Laminin beta 1 Antibody, clone 6I9T4, Rabbit Monoclonal,
• 생물학적 소스: rabbit
• Quality Level: 100
• material: colorless
• 클론: 6I9T4, monoclonal
• 양식: liquid
• 분자량: 250 kDa
• 종 반응성: rat, human, rat
• 농도: 1 mg/mL
• 기술: immunofluorescence: 1:50 - 1:200; western blot: 1:500 - 1:2000
• 색상: colorless
• 동형: IgG
• 면역원 서열: KKTLDGELDEKYKKVENLIAKKTEESADARRKAEMLQNEAKTLLAQANSKLQLLKDLERKYEDNQRYLEDKAQELARLEGEVRSLLKDISQKVAVYSTCL
• UniProt 수납 번호: P07942
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... LAMB1(3912)

설명

일반 설명

Laminins, a family of extracellular matrix glycoproteins, are the major noncollagenous constituent of basement membranes. They have been implicated in a wide variety of biological processes including cell adhesion, differentiation, migration, signaling, neurite outgrowth and metastasis. Laminins are composed of 3 non identical chains: laminin alpha, beta and gamma and they form a cruciform structure consisting of 3 short arms, each formed by a different chain, and a long arm composed of all 3 chains. Different alpha, beta and gamma chain isomers combine to give rise to different heterotrimeric laminin isoforms which are designated by Arabic numerals in the order of their discovery, i.e. alpha1beta1gamma1 heterotrimer is laminin 1. This gene encodes the beta chain isoform laminin, beta 1. The beta 1 chain has 7 structurally distinct domains which it shares with other beta chain isomers. The C-terminal helical region containing domains I and II are separated by domain alpha, domains III and V contain several EGF-like repeats, and domains IV and VI have a globular conformation. Laminin, beta 1 is expressed in most tissues that produce basement membranes, and is one of the 3 chains constituting laminin 1, the first laminin isolated from Engelbreth-Holm-Swarm (EHS) tumor. A sequence in the beta 1 chain that is involved in cell attachment, chemotaxis, and binding to the laminin receptor was identified and shown to have the capacity to inhibit metastasis.

면역원

A synthetic peptide corresponding to a sequence within amino acids 1687-1786 of human Laminin beta 1 (P07942).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

애플리케이션

WB, IF/ICC

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1