SAB1410343

Anti-STX2 antibody produced in rabbit

purified immunoglobulin, buffered aqueous solution

• 동의어(들): EPIM, EPM, MGC51014, STX2A, STX2B, STX2C
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 형태: buffered aqueous solution
• 분자량: antigen 33.3 kDa
• 종 반응성: human
• 기술: western blot: 1 μg/mL
• NCBI 수납 번호: NM_001980.2
• UniProt 수납 번호: P32856
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... STX2(2054)

설명

일반 설명

Syntaxin 2 (STX2) is encoded by the gene mapped to human chromosome 12q24.33. The encoded protein is ubiquitously expressed and is mainly localized to plasma membrane. STX2 is a member of the soluble N-ethylmaleimide-sensitive factor activating protein receptor (SNARE) membrane fusion machinery.

The product of this gene belongs to the syntaxin/epimorphin family of proteins. The syntaxins are a large protein family implicated in the targeting and fusion of intracellular transport vesicles. The product of this gene regulates epithelial-mesenchymal interactions and epithelial cell morphogenesis and activation. Alternatively spliced transcript variants encoding different isoforms have been identified. (provided by RefSeq)

면역원

STX2 (NP_001971.2, 1 a.a. ~ 287 a.a) full-length human protein.

Sequence
MRDRLPDLTACRKNDDGDTVVVVEKDHFMDDFFHQVEEIRNSIDKITQYVEEVKKNHSIILSAPNPEGKIKEELEDLNKEIKKTANKIRAKLKAIEQSFDQDESGNRTSVDLRIRRTQHSVLSRKFVEAMAEYNEAQTLFRERSKGRIQRQLEITGRTTTDDELEEMLESGKPSIFTSDIISDSQITRQALNEIESRHKDIMKLETSIRELHEMFMDMAMFVETQGEMINNIERNVMNATDYVEHAKEETKKAIKYQSKARRKLMFIIICVIVLLVILGIILATTLS

생화학적/생리학적 작용

Syntaxin 2 (STX2) plays a vital role in expression, production and release of tissue plasminogen activator (tPA) protein. In mammalian cells, STX2 facilitates the fusion event required for cytokinesis. Deletion in the STX2 gene might be responsible for defective testicular development.

물리적 형태

Solution in phosphate buffered saline, pH 7.4

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable