SAB1409088

Monoclonal Anti-ANKRD17 antibody produced in mouse

clone 1D8, ascites fluid, solution

• 동의어(들): FLJ22206, GTAR, KIAA0697, NY-BR-16
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• 결합: unconjugated
• 항체 형태: ascites fluid
• 항체 생산 유형: primary antibodies
• 클론: 1D8, monoclonal
• 형태: solution
• 분자량: antigen 37.07 kDa
• 종 반응성: human
• 기술: indirect ELISA: suitable
• 동형: IgG1κ
• NCBI 수납 번호: NM_032217
• UniProt 수납 번호: O75179
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... ANKRD17(26057)

설명

일반 설명

This gene encodes a protein with ankyrin repeats, which are associated with protein-protein interactions. Studies in mice suggest that this protein is involved in liver development. Two transcript variants encoding different isoforms have been found for this gene. (provided by RefSeq)

면역원

ANKRD17 (NP_115593, 2501 a.a. ~ 2603 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
ERDSTGIVTPSGTFHQHVPAGYMDFPKVGGMPFSVYGNAMIPPVAPIPDGAGGPIFNGPHAADPSWNSLIKMVSSSTENNGPQTVWTGPWAPHMNSVHMNQLG

물리적 형태

Clear solution

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable