SAB1400187

Monoclonal Anti-NME2 antibody produced in mouse

clone 1D3, purified immunoglobulin, buffered aqueous solution

• 동의어(들): Anti-MGC111212, Anti-NDPKB, Anti-NM23B, Anti-NM23H2, Anti-puf
• MDL number: MFCD01865221
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 1D3, monoclonal
• 형태: buffered aqueous solution
• 종 반응성: human, mouse, rat
• 기술: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL
• 동형: IgG3κ
• UniProt 수납 번호: P22392
• 배송 상태: dry ice
• 저장 온도: −20°C
• 유전자 정보: human ... NME2(4831)

설명

일반 설명

Nucleoside diphosphate kinase (NDK) exists as a hexamer composed of ′A′ (encoded by NME1) and ′B′ (encoded by this gene) isoforms. Multiple alternatively spliced transcript variants encoding the same isoform have been found for this gene. Co-transcription of this gene and the neighboring upstream gene (NME1) generates naturally-occurring transcripts (NME1-NME2) which encode a fusion protein comprised of sequence sharing identity with each individual gene product. (provided by RefSeq)

면역원

NME2 (NP_002503, 51 a.a. ~ 152 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
HYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE

물리적 형태

Solution in phosphate buffered saline, pH 7.4

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable