HPA037655

Anti-GUCY2C antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• 동의어(들): Anti-GUC2C, Anti-Guanylate cyclase 2C (heat stable enterotoxin receptor), Anti-STAR
• UNSPSC 코드: 12352203
• 인간 단백질 도해서 번호: HPA037655
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 제품 라인: Prestige Antibodies^® Powered by Atlas Antibodies
• 형태: buffered aqueous glycerol solution
• 종 반응성: human
• 기술: immunohistochemistry: 1:200-1:500
• 면역원 서열: EVRGETYLKGRGNETTYWLTGMKDQKFNLPTPPTVENQQRLQAEFSDMIANSLQKRQAAGIRSQKPRRVASYKKGTLEYLQLNTTD
• UniProt 수납 번호: P25092
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... GUCY2C(2984)

설명

일반 설명

The guanylate cyclase 2C (GUCY2C) gene, mapped to human chromosome 12p12, codes for the transmembrane receptor guanylate cyclase C (GC-C). The encoded protein is expressed in intestine.

면역원

guanylate cyclase 2C (heat stable enterotoxin receptor) recombinant protein epitope signature tag (PrEST)

애플리케이션

GUCY2C antibody produced in rabbit has been used for western blot analysis.

생화학적/생리학적 작용

Transmembrane receptor guanylate cyclase C (GC-C), encoded by guanylate cyclase 2C (GUCY2C), regulates the secretion of chloride. Alteration in the gene expression leads to congenital sodium diarrhoea (CSD). GUCY2C catalyzes the conversion of guanosine-5′-triphosphate (GTP) to cyclic guanosine monophosphate (cGMP), upon binding of its ligand guanylin and uroguanylin, which are paracrine hormones. GUCY2C functions as a tumor suppressor and hinders intestinal tumorigenesis by inhibiting the protein kinase B/AKT signaling pathway.

특징 및 장점

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST79587

물리적 형태

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable