HPA035107

Anti-ARHGAP26 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• 동의어(들): Anti-GRAF, Anti-KIAA0621, Anti-OPHN1L, Anti-OPHN1L1, Anti-Rho GTPase activating protein 26
• UNSPSC 코드: 12352203
• 인간 단백질 도해서 번호: HPA035107
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 제품 라인: Prestige Antibodies^® Powered by Atlas Antibodies
• 형태: buffered aqueous glycerol solution
• 종 반응성: human
• 향상된 검증: orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• 기술: immunoblotting: 0.04-0.4 μg/mL; immunohistochemistry: 1:200-1:500
• 면역원 서열: HLSRKKSSDSKPPSCSERPLTLFHTVQSTEKQEQRNSIINSSLESVSSNPNSILNSSSSLQPNMNSSDPDLAVVKPTRPNSLPPNPSPTS
• UniProt 수납 번호: Q9UNA1
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... ARHGAP26(23092)

설명

일반 설명

Rho GTPase activating protein 26(ARHGAP26)/GTPase Regulator Associated with Focal Adhesion Kinase (GRAF) is a multidoman membrane structuring protein involved in clathrin-independent endocytosis. GRAF interacts strongly with dynamin in the CLIC/GEEC pathway.

특이성

Rabbit polyclonal anti-ARHGAP26 antibody reacts with human Rho GTPase activating protein 26/ GTPase Regulator Associated with Focal Adhesion Kinase (GRAF).

면역원

Rho GTPase activating protein 26 recombinant protein epitope signature tag (PrEST)

애플리케이션

Rabbit polyclonal anti-ARHGAP26 antibody is used to tag Rho GTPase activating protein 26/ GTPase Regulator Associated with Focal Adhesion Kinase (GRAF) for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of Rho GTPase activating protein 26/ GTPase Regulator Associated with Focal Adhesion Kinase (GRAF) in clathrin-independent endocytosis involving the CLIC/GEEC pathway.

특징 및 장점

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST78333

물리적 형태

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable