AV35126

Anti-KCNAB1 antibody produced in rabbit

affinity isolated antibody

• 동의어(들): Anti-Potassium voltage-gated channel, shaker-related subfamily, β member 1
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 형태: buffered aqueous solution
• 분자량: 46 kDa
• 종 반응성: rat, dog, bovine, mouse, human, rabbit, guinea pig, horse
• 농도: 0.5 mg - 1 mg/mL
• 기술: western blot: suitable
• NCBI 수납 번호: NP_003462
• UniProt 수납 번호: Q14722
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... KCNAB1(7881)

설명

일반 설명

KCNAB1 codes for a member of potassium voltage-gated channel (shaker-related) protein subfamily. KCNAB1 forms a β subunit and associates with α subunits to form heteromeric complexes that modulate pore formation. Genetic variations in KCNAB1 have been linked to lateral temporal epilepsy.
Rabbit Anti-KCNAB1 antibody recognizes rabbit, canine, human, mouse, rat, chicken, pig, bovine, and zebrafish KCNAB1.

면역원

Synthetic peptide directed towards the C terminal region of human KCNAB1

애플리케이션

Rabbit Anti-KCNAB1 antibody is suitable for western blot applications at a concentration of 1 μg/ml.

생화학적/생리학적 작용

Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. The KCNAB1 gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily.

서열

Synthetic peptide located within the following region: VPESSRASLKCYQWLKERIVSEEGRKQQNKLKDLSPIAERLGCTLPQLAV

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 2
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable